Basic Information | |
---|---|
Taxon OID | 3300017234 Open in IMG/M |
Scaffold ID | Ga0186611_117611 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in f/2-R medium with seawater, 210 ?M silicate, -2 C, 35 psu salinity and 502 ?mol photons light - Fragilariopsis kerguelensis L2-C3 (MMETSP0906) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 823 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -48.1 | Long. (o) | -24.25 | Alt. (m) | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053762 | Metatranscriptome | 140 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186611_1176111 | F053762 | N/A | FKYKTKTKNKYTYTMAFNSTQNNDQIPVAVAAPVEPVVQQEVMTYGEPTEFLIKNNWFGGGNAEITSNGEAVFQMIRMGGSVLFKNCELVINNISGEPILSMKEHTYGSGRAMELCRVDPSSPNPAMTAVPICRVVRNNCKLTLHNRYEVQLLGQTAENYSSSVDCNGNWPKSFTFEASGKELATVQKSSPKNWKLNVSAGGDVLLFIGIACAIDRMSHESKQRKAIIFGTAGAIGAIGTAGN |
⦗Top⦘ |