NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187776_10003122

Scaffold Ga0187776_10003122


Overview

Basic Information
Taxon OID3300017966 Open in IMG/M
Scaffold IDGa0187776_10003122 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8476
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (73.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.2396Long. (o)-73.2024Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001831Metagenome / Metatranscriptome628Y
F016945Metagenome / Metatranscriptome243Y
F085303Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0187776_1000312213F085303AGGMRLGALVIAVTALVVVAAVAQAQEPGRPAPGSFRFEWARRSPSMRPGVDGYVYNDSNWRVTNLRVRAVVVDAAGATVRESVVSVWGNAVPGTRTFFVLPALGEGEIYQLTVVSFDLVSEQTP
Ga0187776_100031224F001831N/AMKAFIVGLCGFCLFLGACAIANTPQQDLAQARWAKCSSPNTTLLRIDLDGRITFRNTSPGDRQAIQRCLAEAGRAGPALPEPVVVDVRDAGA
Ga0187776_100031228F016945AGGMILPIDSRARPPRIVFVTMAAFTAVLAFSAGVWAQAGSGWSLVTPPPVPERRVLMKVYTASSDSDVKAAVANLPGEEQVRLVTKVYKILTIPAAADRTEALLAALQDTAAPVTSWRKLETFDSSTSCERKRERALESFERAAAKVRSEASDADELAVEDWTILEGLTACRMSRCVPESTLSLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.