NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184610_1007849

Scaffold Ga0184610_1007849


Overview

Basic Information
Taxon OID3300017997 Open in IMG/M
Scaffold IDGa0184610_1007849 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2600
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F002111Metagenome / Metatranscriptome592Y
F008327Metagenome / Metatranscriptome335Y
F077140Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0184610_10078491F077140N/APLDLEDAAAGIQSIYQDLLDRAWAEAKARGAKLPPEAQKAIPPTVPGQQ
Ga0184610_10078493F008327AGGAGGMSMPSGDSPNDARDFYLYLQGHHESQHRVETWHVDWLSLAWLWGFVIVLSVVLLLWVRQYRSTRHRAGIYPLDSFGGWTTEAAGPATGFFLLFTGMIVVFAVALIVGHLVWGQKF
Ga0184610_10078494F002111AGAAGMAAAPMAAAPPYVAYSSATEALVPAAEWPALYSSLQALKGHVQEYPGCQGFDVFVRVEAGGDVRVQCYTTWDTYVQLEAFLERGYTFERLLADFGDGLEIERSLTMEKVF
Ga0184610_10078495F000280AGAAGGMARQPRRSDRPARPLMGYRDVGEDVRHSRRAVSRAWIILAVMAVLYLVWTLVIYFLEPGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.