NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187868_1024051

Scaffold Ga0187868_1024051


Overview

Basic Information
Taxon OID3300018002 Open in IMG/M
Scaffold IDGa0187868_1024051 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2882
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008065Metagenome / Metatranscriptome339Y
F085018Metagenome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0187868_10240511F085018GGAGMGKLEVLLLKHTCRAELDRYLRLYSRSFNPDERVSPQVLRWVIQPSPARVNPVHLFAAYLDKRLVGGACTLVLPMFQVV
Ga0187868_10240514F008065GGAGGMRKQFALALGLVLIALASQALAAQKDDTKTQAGNTQRQFGGPAVFGTITSVGVDRFEIKKMDGSTQTVMVDEHTRYRQGQQDIQLEDLKPGDQVSVRGQANSNKEFVAEAVRRATADEMQRFQNAGERVLGAIESIDKNQLKVSNPRQGERIVLVNEQTQFMKDGQPIALKDLKVGDRIFALGKETQGQFLATRVVTGQFRGPGQRRDNQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.