NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188861_1000147

Scaffold Ga0188861_1000147


Overview

Basic Information
Taxon OID3300018563 Open in IMG/M
Scaffold IDGa0188861_1000147 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1520
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)54.570232Long. (o)11.332183Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004235Metagenome / Metatranscriptome447Y
F020386Metagenome / Metatranscriptome224Y
F025320Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0188861_10001472F004235AGGAGGMATSSRTVAPLIAESRMIGKPITMISVDWDVDADGSLLAMEAIHNAILSRGTIIAAGAVYDTGTKQDYILEGNLTDTINNFTSLDGTVSGTLAQVLVEDIVNLGTVDSIDFTSGTVACSIKTTLKFA
Ga0188861_10001473F020386AGGAGMTISRNNFTSLPVAAEQEGVDVSYFTVDFINAMNSETGDPQADSTAAGLALVQAAIMNQGINILATGPLGNANTELTYMVRTDSLDVANHITANGLRDAIRAVDTAGRAASAIPRNTANFSSATVTAKTLAIAV
Ga0188861_10001474F025320AGGAGMTTKINPTKLNTTDHLSGKTITAVTVDFAVNGTDFSSTEMGPLGAVQAAIATMTQEATPIIITKLRSDGSNAGQVFDMVFEGEFGTDTYDGTNSEAFAAYLQTVVRLLTSVGAGSVNLNSATVVAATAASF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.