Scaffold Ga0137408_1489154

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137408_1489154

Scaffold Ga0137408_1489154

Overview

Basic Information
Taxon OID	3300019789 Open in IMG/M
Scaffold ID	Ga0137408_1489154 Open in IMG/M
Source Dataset Name	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2753
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	39.7291	Long. (^o)	-123.6419	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075808	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137408_14891543	F075808	AGGAG	MADRYTLDGFVITKMEPPGAPHAGADRGRLFINEAQTGVMAWWSMGRWANVAVREAVIVQAPP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.