Scaffold Ga0206388_1116774

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0206388_1116774

Scaffold Ga0206388_1116774

Overview

Basic Information
Taxon OID	3300019861 Open in IMG/M
Scaffold ID	Ga0206388_1116774 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3344
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	36.0	Long. (^o)	-97.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106197	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206388_11167744	F106197	GGCGG	MKKVLVCIILLSLWICVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWQRAPPVPVYAEPGESTYFVNPVWHIPDDAELGSYQADFYLYSYYDSNTGEFSEQLDQVDQAGAFSVVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.