Scaffold Ga0208086_1000534

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208086_1000534

Scaffold Ga0208086_1000534

Overview

Basic Information
Taxon OID	3300020510 Open in IMG/M
Scaffold ID	Ga0208086_1000534 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11433
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (84.21%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Lake Mendota, Madison, Wisconsin, USA
Coordinates	Lat. (^o)	43.098333	Long. (^o)	-89.405278	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065719	Metagenome / Metatranscriptome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208086_100053416	F065719	AGG	MELVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.