Scaffold Ga0224704_1038037

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224704_1038037

Scaffold Ga0224704_1038037

Overview

Basic Information
Taxon OID	3300021558 Open in IMG/M
Scaffold ID	Ga0224704_1038037 Open in IMG/M
Source Dataset Name	Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co6ic19 200bp no Eukaryotes last
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	710
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → C. Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina 'control' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.828217	Long. (^o)	150.820517	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008031	Metagenome / Metatranscriptome	340	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224704_10380372	F008031	AGGAGG	MATYKSDAGAILEPGNQIGRLSSFNHEGVKGWPGVEAFELIGFHKVSSKSGAKANHKSFNITIPSPDRRPDDRVRSDRSSLVVNASSDRPAYIYQASIAIGQDIPSGGLPSFPASPVTADIGGTNTEVILLGPDNGGAPLGVPSTQQNGLAAATSTLTFSGTTIDQGTSNVSVGKLPFW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.