Basic Information | |
---|---|
Taxon OID | 3300023313 Open in IMG/M |
Scaffold ID | Ga0256748_1132618 Open in IMG/M |
Source Dataset Name | Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-BM1-B4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Delaware |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 714 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | International: Urashima Vent Field, Mariana Arc | |||||||
Coordinates | Lat. (o) | 12.92235 | Long. (o) | 143.64925 | Alt. (m) | Depth (m) | 2929.9 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013646 | Metagenome / Metatranscriptome | 269 | N |
F028523 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256748_11326181 | F013646 | N/A | INTRTQQADDITITGGNEITGLYTVVSGAVATASEHDFGFSEFVSPDFDTSMPYRVAVQPTFTGLGAAANAVTGGGGIMQYNMPRGQGIPLADKVTITTYFTNRDARAAGASNFINFVRYTK |
Ga0256748_11326182 | F028523 | GGTGG | MPHLNGELQPSQVKSLAVYDVASYGTDLFLPLTDVGLTETALTFSGVTMTRDTSDSNQPLDSFPRVYSDTDSGLLLNEGSNTVYNQTYTLDPDMTAVIYKLSLNFCAVLTC |
⦗Top⦘ |