NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256748_1132618

Scaffold Ga0256748_1132618


Overview

Basic Information
Taxon OID3300023313 Open in IMG/M
Scaffold IDGa0256748_1132618 Open in IMG/M
Source Dataset NameHydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-BM1-B4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)714
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location NameInternational: Urashima Vent Field, Mariana Arc
CoordinatesLat. (o)12.92235Long. (o)143.64925Alt. (m)Depth (m)2929.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013646Metagenome / Metatranscriptome269N
F028523Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0256748_11326181F013646N/AINTRTQQADDITITGGNEITGLYTVVSGAVATASEHDFGFSEFVSPDFDTSMPYRVAVQPTFTGLGAAANAVTGGGGIMQYNMPRGQGIPLADKVTITTYFTNRDARAAGASNFINFVRYTK
Ga0256748_11326182F028523GGTGGMPHLNGELQPSQVKSLAVYDVASYGTDLFLPLTDVGLTETALTFSGVTMTRDTSDSNQPLDSFPRVYSDTDSGLLLNEGSNTVYNQTYTLDPDMTAVIYKLSLNFCAVLTC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.