Scaffold Ga0247666_1000156

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247666_1000156

Scaffold Ga0247666_1000156

Overview

Basic Information
Taxon OID	3300024323 Open in IMG/M
Scaffold ID	Ga0247666_1000156 Open in IMG/M
Source Dataset Name	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	28856
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (55.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	40.4449	Long. (^o)	-87.0297	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105755	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247666_100015611	F105755	GGCGG	LVLRPRIVLAAFLLFAACGTYVPRYAFHAAQENQAHIDKVRIGQTLAEVQRIMGKAPERRNTHVRFDGISIEEWSYITDYVRKMDATITFVGGKVAEINTAKWEND

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.