Scaffold Ga0209210_1030223

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209210_1030223

Scaffold Ga0209210_1030223

Overview

Basic Information
Taxon OID	3300025015 Open in IMG/M
Scaffold ID	Ga0209210_1030223 Open in IMG/M
Source Dataset Name	Contaminated groundwater microbial communities from Rifle, Colorado, USA - Rifle Groundwater A1 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2033
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Contaminated Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location Name	Rifle, Colorado, USA
Coordinates	Lat. (^o)	39.53	Long. (^o)	-107.78	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080249	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209210_10302231	F080249	GGAG	MADDKKKVKEDRNLISFKEHYEVYYAVNQLKKQFPDETKADIKDALFDAAKQVKPSEGREKIMRLARKDLRD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.