NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209082_1176733

Scaffold Ga0209082_1176733


Overview

Basic Information
Taxon OID3300025123 Open in IMG/M
Scaffold IDGa0209082_1176733 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)635
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCold Creek Source, Nevada
CoordinatesLat. (o)36.41Long. (o)-115.74Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036462Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0209082_11767331F036462N/ASSPHYILEKEENMSQQVRLGDFLGNELEEDFASFDLTEIQQVLVNLQSTDAIDLAHAELLQQQSLRGADILTEYLGKIVKTVGYLEAKVNRTKNAVSLAYQAPEGRTTAEMKKWAGESSPEVEEVQIKLAKAKGSKLVLERKYEILIKSHHHFKDIAMGLRRTVLGYSSGTATADRVPEGYE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.