NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207681_10000016

Scaffold Ga0207681_10000016


Overview

Basic Information
Taxon OID3300025923 Open in IMG/M
Scaffold IDGa0207681_10000016 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)345352
Total Scaffold Genes311 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)252 (81.03%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013934Metagenome / Metatranscriptome267Y
F079250Metagenome116Y
F083124Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0207681_10000016136F083124AGGAGMEIVERESIVDEILDEIVPEGLDWERLVVSYPIPALLLAAVGGFLLGRRHGTEILSAVSGYAAAEVSRNVSQVLGQEIG
Ga0207681_10000016165F079250AGGVNAARRTLGRWLLAAFLERGCDPATARVPRRVLSIRPLTPREMAELNPLWQSLVPVSNLLPWPRSISRPVYEV
Ga0207681_10000016301F013934AGGMRMNKANLERLQILLKGHEEMLEEKRARPEGVLRKNDPFREQFSQVARSVIVPVLEEIKDVMVGKVESASIFHRSTAAGLKVKLDRWEDYERSLLFFGDDSTQIVKITHEGIGFGLLSTKVPVHQLDAELVEEEAMKFLKRLFGQEQLRRPSAAQDGGVPTGGPGGNARRPPVGTAARSGYEFIRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.