NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207687_10860399

Scaffold Ga0207687_10860399


Overview

Basic Information
Taxon OID3300025927 Open in IMG/M
Scaffold IDGa0207687_10860399 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)775
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078778Metagenome / Metatranscriptome116N
F094485Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0207687_108603991F078778AGGAGMRNALLRAMHREEGYSLVISMLLMAIMMVLLAVSLDAGSASLRQSSLSLEWSKALTVAEGGADAAVTTLGESRAATNNCAIGTNNVCNAVDGQYQVRWTSSGSQIVVTSVGYYPTKADAQFA
Ga0207687_108603992F094485N/ANRRDVLADGRIAIDQMTKQLRQGESVDLTTSNAYTLKFSGYIDGTQSTIEWRVTGTSAPYTLEQSRDGGAHFAPLVSPILCKTASDTGCSEDPFTLIQHAGVVDQVTIDLTFQTNTSTVDLISDVQLRNVET
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.