NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207712_10018609

Scaffold Ga0207712_10018609


Overview

Basic Information
Taxon OID3300025961 Open in IMG/M
Scaffold IDGa0207712_10018609 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4527
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017669Metagenome / Metatranscriptome239Y
F079825Metagenome / Metatranscriptome115Y
F100632Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0207712_100186092F079825GAGMAPLALYETASVAMAQVFLTFATHVKGQTLYEKMVEEKFLGIRGAR
Ga0207712_100186093F017669GGAMATILAADYGRDDFLALGSPLVSTLQAWGYEVVEAENSLDVLQQASRVHPDAVLLYDTLPALEALRAMLHQHVATQHIPILILHEQVQQMQFTDMVMVDPQYRLGKSPRQFDPYELRRLLEQVFA
Ga0207712_100186094F100632GGAGMAERKSISTMHVFWKEQEGAPGGWYIETRNAYSETVGDSRQPDWDGPPPMNYQKHDAEKLCAHLQLWEPEARVVMHL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.