NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207703_10143463

Scaffold Ga0207703_10143463


Overview

Basic Information
Taxon OID3300026035 Open in IMG/M
Scaffold IDGa0207703_10143463 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2075
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008364Metagenome / Metatranscriptome334Y
F045815Metagenome / Metatranscriptome152Y
F081403Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0207703_101434631F081403AGGAGMNPRKNTILILLLGLLLVAFSAASAQTPAQGDQKKDAEACCAKDSCCKDDSCEMKKEGEANSEAKHDCCGDSCDMKKHDENMKHDKDTKHEC
Ga0207703_101434632F045815AGTAGMLLFSNKAIRLLLAAGVSIWMAGGCLFGCANTTMCAEVSHESHNGVAAAPSCHAKQSLANMPSFVPDPRGMMNECPLVVNATAAISKNSTHVPDSTRGAIAALPSFEKQIEYTDTTLVAPFLPNRGPTHLRCCVFLI
Ga0207703_101434635F008364N/AFVGDLPSYPQRAEEYSNSLAKRIPEYKKISEGPTKVNSMQGYEFRWEGLSKGTDRGDLKLWGRVIFLPTGTEGDATGATLTMLTTSLAGELNSVEDVGQRGEMPVILDSFRFGKQK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.