Scaffold Ga0209370_1145578

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209370_1145578

Scaffold Ga0209370_1145578

Overview

Basic Information
Taxon OID	3300027606 Open in IMG/M
Scaffold ID	Ga0209370_1145578 Open in IMG/M
Source Dataset Name	Agave microbial communities from Guanajuato, Mexico - At.P.rz (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → Asparagales → Asparagaceae → Asparagoideae → Asparagus → Asparagus officinalis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Guanajuato, Mexico
Coordinates	Lat. (^o)	20.6863	Long. (^o)	-101.8747	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046122	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209370_11455781	F046122	N/A	DEEGEWIINDDISFDYPASIESIKSIMDGSLRMPVHEPSSAITSVEVIEGATLVIPPSKQGQSPIIFGRARPGRFSTTDSSSDSEVPQFFHYAPSARHIMKKMGYNLKQGAGLNFGKGRRGLMRNSVPRGKPANYYDSTRRGLGYVTPTSSTTVPVKGDGSIPSQSTSSSE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.