NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208304_10038047

Scaffold Ga0208304_10038047


Overview

Basic Information
Taxon OID3300027751 Open in IMG/M
Scaffold IDGa0208304_10038047 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1897
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055543Metagenome / Metatranscriptome138N
F087173Metagenome / Metatranscriptome110Y
F099271Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0208304_100380472F055543AGAAGMITSLTYMIVLMGAATVTLSVYVAIRFFIKHVTMRGDGRRLTGALVFMLAGESILGLGTLAFAIAAHTGHLPHIPIEVQSAARLLMFGATSLSTLHLFMVIMKLDEDE
Ga0208304_100380476F099271N/AMNEPKETTPLDAMVAGLNKLYDAMESPPAPPADEEEETETKENKWIH
Ga0208304_100380477F087173AGGAGMDTLENICQGGGMNGHTFNISTAAVQIGYRSGYYQKSAIKNTDGQTVWH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.