NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209517_10007371

Scaffold Ga0209517_10007371


Overview

Basic Information
Taxon OID3300027854 Open in IMG/M
Scaffold IDGa0209517_10007371 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13210
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (85.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009829Metagenome / Metatranscriptome312Y
F011360Metagenome / Metatranscriptome291Y
F079157Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209517_1000737110F009829AGGAGMFARIIEFAPKWEKKEEFIKTLKNDVLPILKRQTGFLEIMPFFPETKDEKCVNITLWMEKKDAERYEREVFPKVNDILKPYLTTPITWKLYNVETTVCEHFVNALAA
Ga0209517_1000737112F011360AGGAGMAAYGQWITKSARIGASFGGVAGFLYAAYVMATSANLGWTDVLDAVGSVVAVFIFAVIIGSFCIAIGCLAGLVLGVVSSPLGHLLKSARVMPSGPPA
Ga0209517_1000737116F079157AGGAGGMQRADLLKPDILSEIVLLGSGVLIFVLLLLVVLTALTRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.