Basic Information | |
---|---|
Taxon OID | 3300028031 Open in IMG/M |
Scaffold ID | Ga0256847_1220083 Open in IMG/M |
Source Dataset Name | Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - Teddybear |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 627 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean: East Pacific Rise | |||||||
Coordinates | Lat. (o) | 9.8472 | Long. (o) | -104.2975 | Alt. (m) | Depth (m) | 2514 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079616 | Metagenome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256847_12200831 | F079616 | N/A | MNNTFEIGEIVVCVNAKRRWYRLGGLQENEMYTVTGFNPYDGGLILKEVKSPKSGYNAFAASRFRKADYNFAENVLTELQPQEYEVAAIKNYELSVLN |
⦗Top⦘ |