NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265338_10302260

Scaffold Ga0265338_10302260


Overview

Basic Information
Taxon OID3300028800 Open in IMG/M
Scaffold IDGa0265338_10302260 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1163
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011543Metagenome / Metatranscriptome290Y
F059472Metagenome / Metatranscriptome134Y
F073775Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0265338_103022602F059472GGAGMTHPILNRILMLDKVAGERVREHQRRSMSAAAIVGILIAFVMLEYHLLVEHRVPWDLIAVIYAMGLTKIALMRWYHYKN
Ga0265338_103022603F011543AGGAMFDIDTCNLKKSLPLLIALLVVAQVDLASAFGWPQSLLSLLHLTAATNDLCSGVCAGLGTSIDVLVIYQLARIWAKPAFEASRDTRHD
Ga0265338_103022604F073775AGGAGMHPMFSRLDQKHRRLFRIANVALILGLVPWVFRESITVNHDWLDAWCGFFMGLSVTINLVCLRAARRCPRTQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.