NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168853_101705

Scaffold Ga0168853_101705


Overview

Basic Information
Taxon OID3300029113 Open in IMG/M
Scaffold IDGa0168853_101705 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021310-108
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16210
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location NameChina: Beijing, Peking Union Medical College
CoordinatesLat. (o)39.911947Long. (o)116.4156125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097172Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0168853_1017053F097172AGGAGGMKKNVLKKLMCAVLAAACVATAVVPAMADDVVTAEAATKSVTSVYKYHLEGCDKKGYVMDGFSKSSFYKDLNSLPAVKMGKTTINVPAVTSSVKSISKEKGKPRYESFVKFKAPKTGKYVFTLDNLQGTDDKSLKCFYYGFCKPIKNGKKYTLENLYPDTVGNYGDLYENNYLAKFRTIFDNYKAEHPEYADAIDETYNDESEYVSKHPVNKIKFTTKLKKGRTYVFSVDNIGMAEPCKPYLDDFGSDHQSCLSGGNYLKAYSFDMNIEYKK
Ga0168853_1017054F097172AGGAGGMKKNVLKKLMCAVLAVACVATAVVPAMADNVVTAEATTKKVTSVYKYHLEGYDKKGYVMDGFSKVAFYKDLNSLPAVKTGKTTINVPAVTSSVKSVSKEKGKPRYESFVKFKAPKTGKYVFTLNNLQGTDDKSLKCFGGGIYKPVKNGKKYTLEDLYPDEVGDYTTLYENNYLAKFRTIFDNYKAEHPEYADAIDETYNDESEYVSKHPVNKIKFTTRLKKGQTYVYVIDNIGMAEPCKPYLDDFGSDHQSCLSGGNYLKAYSFDMNIEYRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.