 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300029313 Open in IMG/M |
| Scaffold ID | Ga0242781_100374 Open in IMG/M |
| Source Dataset Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_10_stool_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 72457 |
| Total Scaffold Genes | 73 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 68 (93.15%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076190 | Metagenome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0242781_10037453 | F076190 | N/A | VRTAGGSITISAKNVFMAASRVSGRVWSLVRITVPNGLKYVKIRVEKPQNNSLYPYFQREPL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |