NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0239578_1034481

Scaffold Ga0239578_1034481


Overview

Basic Information
Taxon OID3300029317 Open in IMG/M
Scaffold IDGa0239578_1034481 Open in IMG/M
Source Dataset NameOil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLawrence Berkeley National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1151
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location NameUSA: Gulf of Mexico
CoordinatesLat. (o)24.74Long. (o)-88.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101886Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0239578_10344812F101886N/AKKSAIIGFCLFNVVLFILIGIEVAAVTPERAMSEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLVVIQAWFLYWAKNKINAANAAVPS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.