Scaffold Ga0185543_1001224

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0185543_1001224

Scaffold Ga0185543_1001224

Overview

Basic Information
Taxon OID	3300029318 Open in IMG/M
Scaffold ID	Ga0185543_1001224 Open in IMG/M
Source Dataset Name	Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7514
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (61.11%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Indian Ocean: TARA_038
Coordinates	Lat. (^o)	19.0393	Long. (^o)	64.4913	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056155	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0185543_100122410	F056155	AGGTGG	MRMAADFLPPYVNPGQGCAKKPEEYPAKPRGGFSHGPKLLGQRNG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.