Basic Information | |
---|---|
Taxon OID | 3300029429 Open in IMG/M |
Scaffold ID | Ga0239577_1048367 Open in IMG/M |
Source Dataset Name | Oil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Lawrence Berkeley National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 646 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 24.74 | Long. (o) | -88.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101886 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0239577_10483671 | F101886 | N/A | QVKKEEKTMLKKIAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAILWGVILYTILTVKKEHFLRASYLYLGFYLCDIHFSHYMSVEMNDPYFTPGALALVAIQIGFLFWAKIRINTANLALSN |
⦗Top⦘ |