NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307343_101008

Scaffold Ga0307343_101008


Overview

Basic Information
Taxon OID3300029657 Open in IMG/M
Scaffold IDGa0307343_101008 Open in IMG/M
Source Dataset NameMetatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_His2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2735
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leucobacter → unclassified Leucobacter → Leucobacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020914Metagenome / Metatranscriptome221N
F067770Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0307343_1010083F020914AGAAGGMAIYQKYGFAIDQILSEDQALPTYPQPGDSANTIKLDAVADDGLHIVVCAASTTVELASDATLEIRPTVGLTANAVTTVLPSILITQGVQSDVSWASGEMICQFNIPAKLIGSARYLKLTYVTSANESAEKVEAFSVRR
Ga0307343_1010085F067770GAGMIEFKYNSPIFKLGKISRSEWRELGMSARSEIVKRTRNGIDINHQPFHEYSAATQEYKSGIMQTRGLGSSVVTLQDTGQMHRSLSIEVQANAAILYYADQNRARVALLHQTGGFHLPKREHFGFNKTDGDRYLERIAKLQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.