Basic Information | |
---|---|
Taxon OID | 3300029890 Open in IMG/M |
Scaffold ID | Ga0246099_100005 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2157 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Berkeley |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 515733 |
Total Scaffold Genes | 479 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 392 (81.84%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan: Horonobe URL | |||||||
Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | Depth (m) | 140 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044411 | Metagenome / Metatranscriptome | 154 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0246099_100005105 | F044411 | N/A | MQTSPGFNQVYPGQAIAICSRAQAAQLVDYDHHTVRIQGRLGVLLTYPWLPLDENPGPFVLTVVFHHAEKHPAAPEAVQTLVDGLKFQFRGQAR |
⦗Top⦘ |