NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187737_129325

Scaffold Ga0187737_129325


Overview

Basic Information
Taxon OID3300030668 Open in IMG/M
Scaffold IDGa0187737_129325 Open in IMG/M
Source Dataset NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 12_T2E_StrKB8 developmental time series (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)512
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004725Metagenome / Metatranscriptome426Y

Sequences

Protein IDFamilyRBSSequence
Ga0187737_1293251F004725N/AVKPTFQFSAAIVPMATSAPLLGKQGKAAHSKASIFYGADEYLEELKKKYEHDHEIAALKNALPGEGDPNAAGVAQSNDKMLSVQKNDENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFFTQVLMVIGYCAALATFPDYWWTCTLCFGLPFSYIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.