NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307500_10115126

Scaffold Ga0307500_10115126


Overview

Basic Information
Taxon OID3300031198 Open in IMG/M
Scaffold IDGa0307500_10115126 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)45.6996Long. (o)-121.669Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001600Metagenome / Metatranscriptome665Y
F083142Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0307500_101151261F001600GAGMSGTIQLAALSTVLAGTMMSGTLLAQTHKEYRFNVGPRAAISVNNPYGSVSVKPSTGNVVVISAILFSDKVEVDNALVGNRVEVQSHLLSGADAQSGRVEYEILVPADASLTMHSSSGTLRAEKLHGDMSLEGAAATVDVR
Ga0307500_101151262F083142N/AAAQPTIVSDAAIAGLNDDDLLQEVAQQSPALQEQYADNLRRVNQYIQDAKNIVAAEPDDEEARRSLMEAYQEKAMLFELALDRSLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.