NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318516_10007916

Scaffold Ga0318516_10007916


Overview

Basic Information
Taxon OID3300031543 Open in IMG/M
Scaffold IDGa0318516_10007916 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4996
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001404Metagenome / Metatranscriptome704Y
F004985Metagenome / Metatranscriptome416Y
F090814Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0318516_100079163F004985GGAMKKLIAGALIVCVSIVLVAWAITRHVNNKQDAEWCHENGYTNYATKDGFCVGARGKLIKVGRQ
Ga0318516_100079165F001404GGAGMRTSNTCLFAVTAALLATGFAVWVASPTNARVSLSIGQGIQPFQLMMSAKELPTVEFVDYTFVFN
Ga0318516_100079167F090814GAGVPTLAQIYEDHAAACTRAAEQCDDPVFRDMLNSLALQWRLAAHEEVAKQSTRPKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.