Scaffold Ga0334665_111500

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334665_111500

Scaffold Ga0334665_111500

Overview

Basic Information
Taxon OID	3300032209 Open in IMG/M
Scaffold ID	Ga0334665_111500 Open in IMG/M
Source Dataset Name	Metatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1072
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Aquatic Microbiome From Duckweeds Obtained From Rutgers Duckweed Stock Cooperative (rdsc)

Source Dataset Sampling Location
Location Name	USA: Knoxville, Tennessee
Coordinates	Lat. (^o)	35.9573	Long. (^o)	-83.9276	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037234	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334665_1115001	F037234	N/A	NYEKMNKYLGLDPKASDLTMIRVVKARTGYRCKDIR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.