Basic Information | |
---|---|
Taxon OID | 3300033002 Open in IMG/M |
Scaffold ID | Ga0346503_1136745 Open in IMG/M |
Source Dataset Name | Soil microbial community from agricultural field in Dibrughar, Assam, India - D1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Eurofins Genomics India Pvt Ltd. |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1371 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Crude Oil Contaminated Agricultural Soil Mecrobial Communities From Various Regions In India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Dibrughar, Assam, India | |||||||
Coordinates | Lat. (o) | 26.2006043 | Long. (o) | 92.9375739 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091988 | Metagenome / Metatranscriptome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0346503_11367453 | F091988 | N/A | AQASQDTLTLTLTMSGVDYEEKVSNYRVTGFEKLVCNPYIGAKEPVAVMLQSYDVKPGDPTQVVYTYSLKGNTTSELNLTMDWTIGPCAPAFDESNVKAPRNPLLTNYHFEFNVPVK |
⦗Top⦘ |