NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0346503_1143505

Scaffold Ga0346503_1143505


Overview

Basic Information
Taxon OID3300033002 Open in IMG/M
Scaffold IDGa0346503_1143505 Open in IMG/M
Source Dataset NameSoil microbial community from agricultural field in Dibrughar, Assam, India - D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterEurofins Genomics India Pvt Ltd.
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)785
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Crude Oil Contaminated Agricultural Soil Mecrobial Communities From Various Regions In India

Source Dataset Sampling Location
Location NameDibrughar, Assam, India
CoordinatesLat. (o)26.2006043Long. (o)92.9375739Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063927Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0346503_11435052F063927GGAGGVIEQLRDSLSALSLSAVDARLENLLEHAAKAEPSYGDFLLDVLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.