Sample 2088090000

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 2088090000

2088090000: Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549

Overview

Basic Information
IMG/M Taxon OID	2088090000 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0046228 \| Gp0051877 \| Ga0010749
Sample Name	Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549
Sequencing Status	Permanent Draft
Sequencing Center	Macrogen
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	299856225
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway
Type	Host-Associated
Taxonomy	Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	Longyearbyen, Svalbard
Coordinates	Lat. (^o)	78.2166667	Long. (^o)	15.6333333	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036881	Metagenome / Metatranscriptome	169	Y
F093041	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
SRMUA_GMSDS1U03GOL3O	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
SRMUA_GMSDS1U03GR1NX	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	508	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
SRMUA_GMSDS1U03GOL3O	SRMUA_06894150	F036881	LPVSVQLQFFSGADVEFDAVHELFLVAQPNSSSSNGSSIYVYDTNGNLQETLNGFSFSNAFNVVPAHIALNPSKRTGFVDGPSSNVNELQHFTY
SRMUA_GMSDS1U03GR1NX	SRMUA_05074510	F093041	MKLSSPFLACQQYHDDRKAKSQKAFRRAALLRSKTAPLFCPVLIAMSIGRMIQRIIRCQTCRLAAKSIETSIDIAIRCSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.