NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000660

3300000660: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16



Overview

Basic Information
IMG/M Taxon OID3300000660 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0075432 | Gp0054715 | Ga0001939
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1426043
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C491

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biometropical forestforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000466Metagenome / Metatranscriptome1105Y
F007624Metagenome / Metatranscriptome348N
F028105Metagenome192Y
F065994Metagenome / Metatranscriptome127Y
F085267Metagenome111N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12415J11908_10001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales3289Open in IMG/M
JGI12415J11908_10043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1413Open in IMG/M
JGI12415J11908_10135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila832Open in IMG/M
JGI12415J11908_10248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
JGI12415J11908_10344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49529Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12415J11908_10001JGI12415J11908_100014F007624REGGRLCSEPMQLREGSFHGPRPGCPEHPKQRVHRHGFYVRFENCDSQRRLRIERFVCPRCGRTLSILPKNRLPYIAVNATLVESEFDARTSGTDPPSSSEKERGCLRRAFERFAARVTPVCALLGQMITRIKPSVGECWKELRQLDNLEGILLLLGTKFNTSLLADYRCVQSGF*
JGI12415J11908_10043JGI12415J11908_100431F085267MSFLRHGEIYPWHEGTISRPCPRPSQWMSFQPVIPGGLLSSRARVRFTSRRH
JGI12415J11908_10135JGI12415J11908_101352F028105GGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG*
JGI12415J11908_10248JGI12415J11908_102481F000466MAHLLTYMTTPEAWQRWKKLPSQGVVKRDWVPTGRIDFATRFYGNLEDSDQPSEFKLIVEERRIVESITGNENLEIQWRLATLNEAKVVVAQYHKYLSENSLIKSVFDEPASLPPPKRIQKIQESTAA*
JGI12415J11908_10344JGI12415J11908_103443F065994MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.