NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065994

Metagenome / Metatranscriptome Family F065994

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065994
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 44 residues
Representative Sequence MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSX
Number of Associated Samples 116
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.33 %
% of genes near scaffold ends (potentially truncated) 90.55 %
% of genes from short scaffolds (< 2000 bps) 97.64 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.402 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.535 % of family members)
Environment Ontology (ENVO) Unclassified
(33.071 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.118 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.44%    β-sheet: 0.00%    Coil/Unstructured: 80.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF04392ABC_sub_bind 2.40
PF01135PCMT 0.80
PF00233PDEase_I 0.80
PF13518HTH_28 0.80
PF01527HTH_Tnp_1 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.40
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.80
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.80
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.80
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.40 %
UnclassifiedrootN/A12.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000660|JGI12415J11908_10344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49529Open in IMG/M
3300000699|JGI12536J11923_103630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49542Open in IMG/M
3300000701|JGI12340J11893_100397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 18441272Open in IMG/M
3300000725|JGI12588J11881_103362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49691Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1058897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300001108|JGI12647J13326_102445All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300001155|JGI12625J13251_10168Not Available1046Open in IMG/M
3300001383|JGI20194J14741_1011810All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300001661|JGI12053J15887_10419093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300002245|JGIcombinedJ26739_101083140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales688Open in IMG/M
3300003351|JGI26346J50198_1014867Not Available754Open in IMG/M
3300003569|Ga0007420J51693_1039488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49577Open in IMG/M
3300004082|Ga0062384_101394619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49516Open in IMG/M
3300004281|Ga0066397_10076551All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300004633|Ga0066395_10449334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49735Open in IMG/M
3300004800|Ga0058861_12020399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales899Open in IMG/M
3300004801|Ga0058860_12213357All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300005178|Ga0066688_10220110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1209Open in IMG/M
3300005180|Ga0066685_10428337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales919Open in IMG/M
3300005363|Ga0008090_14265320Not Available555Open in IMG/M
3300005454|Ga0066687_10207973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1072Open in IMG/M
3300005556|Ga0066707_11017121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49505Open in IMG/M
3300005574|Ga0066694_10374949All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005618|Ga0068864_101225046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49749Open in IMG/M
3300005713|Ga0066905_101113407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300005764|Ga0066903_105134173Not Available693Open in IMG/M
3300005764|Ga0066903_107032038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300005947|Ga0066794_10192218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300006086|Ga0075019_10781393Not Available607Open in IMG/M
3300006175|Ga0070712_101811344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49534Open in IMG/M
3300006755|Ga0079222_10452064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300006864|Ga0066797_1208143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300010043|Ga0126380_11467497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300010048|Ga0126373_11284664Not Available798Open in IMG/M
3300010101|Ga0127481_1062717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49554Open in IMG/M
3300010152|Ga0126318_10070760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49553Open in IMG/M
3300010154|Ga0127503_10722245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49534Open in IMG/M
3300010358|Ga0126370_11480853Not Available644Open in IMG/M
3300010361|Ga0126378_13360364Not Available508Open in IMG/M
3300010854|Ga0126360_1041804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49588Open in IMG/M
3300010855|Ga0126355_1131184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49529Open in IMG/M
3300010858|Ga0126345_1052633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49586Open in IMG/M
3300010862|Ga0126348_1214960All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010865|Ga0126346_1183469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300012212|Ga0150985_116251942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49585Open in IMG/M
3300012212|Ga0150985_118407640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49596Open in IMG/M
3300012469|Ga0150984_101211110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49560Open in IMG/M
3300012929|Ga0137404_12018334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49538Open in IMG/M
3300012971|Ga0126369_11879315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium genosp. SA-3687Open in IMG/M
3300012971|Ga0126369_13596634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49508Open in IMG/M
3300012984|Ga0164309_10791908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei762Open in IMG/M
3300012984|Ga0164309_10791908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei762Open in IMG/M
3300013306|Ga0163162_11616684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales739Open in IMG/M
3300014164|Ga0181532_10809857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49502Open in IMG/M
3300016294|Ga0182041_10826669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium829Open in IMG/M
3300016294|Ga0182041_12166508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium519Open in IMG/M
3300018072|Ga0184635_10216681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei762Open in IMG/M
3300018072|Ga0184635_10216681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei762Open in IMG/M
3300019161|Ga0184602_126467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales782Open in IMG/M
3300019165|Ga0184589_126315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49576Open in IMG/M
3300019185|Ga0184587_122336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49577Open in IMG/M
3300019187|Ga0184584_130709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49524Open in IMG/M
3300019242|Ga0181502_1183086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300019284|Ga0187797_1480157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49679Open in IMG/M
3300019284|Ga0187797_1772692Not Available542Open in IMG/M
3300020070|Ga0206356_10929893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49699Open in IMG/M
3300021307|Ga0179585_1083915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49551Open in IMG/M
3300021374|Ga0213881_10600334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49502Open in IMG/M
3300021560|Ga0126371_11075157Not Available944Open in IMG/M
3300021855|Ga0213854_1141945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300021855|Ga0213854_1347630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1567Open in IMG/M
3300021860|Ga0213851_1347350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49535Open in IMG/M
3300021861|Ga0213853_10970485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49685Open in IMG/M
3300022195|Ga0222625_1213815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300023046|Ga0233356_1017581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300023656|Ga0247547_103774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49514Open in IMG/M
3300025432|Ga0208821_1067726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49608Open in IMG/M
3300025457|Ga0208850_1002699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4186Open in IMG/M
3300025481|Ga0208079_1096799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300025852|Ga0209124_10225091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49732Open in IMG/M
3300025901|Ga0207688_10623744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49680Open in IMG/M
3300025925|Ga0207650_11143689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49663Open in IMG/M
3300026271|Ga0209880_1077028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49697Open in IMG/M
3300026285|Ga0209438_1189495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49545Open in IMG/M
3300026481|Ga0257155_1058144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium610Open in IMG/M
3300026490|Ga0257153_1082449Not Available644Open in IMG/M
3300026860|Ga0207823_111005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49624Open in IMG/M
3300026990|Ga0207824_1034092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300027061|Ga0209729_1037084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49612Open in IMG/M
3300027181|Ga0208997_1027811Not Available815Open in IMG/M
3300027680|Ga0207826_1105535All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300027680|Ga0207826_1167385All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300028828|Ga0307312_11028621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300029951|Ga0311371_11840094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49652Open in IMG/M
3300030509|Ga0302183_10319368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49599Open in IMG/M
3300030738|Ga0265462_11510002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49626Open in IMG/M
3300030763|Ga0265763_1009091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49898Open in IMG/M
3300030763|Ga0265763_1013522All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300030863|Ga0265766_1016798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300030903|Ga0308206_1138221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300030987|Ga0308155_1031012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300031018|Ga0265773_1015438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300031043|Ga0265779_110224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49574Open in IMG/M
3300031082|Ga0308192_1078387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031092|Ga0308204_10166682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49665Open in IMG/M
3300031123|Ga0308195_1071082Not Available540Open in IMG/M
3300031226|Ga0307497_10662869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300031543|Ga0318516_10438359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium751Open in IMG/M
3300031546|Ga0318538_10519694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300031663|Ga0307484_113754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49571Open in IMG/M
3300031679|Ga0318561_10530477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49648Open in IMG/M
3300031679|Ga0318561_10584118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300031753|Ga0307477_10378919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria970Open in IMG/M
3300031780|Ga0318508_1225855Not Available537Open in IMG/M
3300031781|Ga0318547_10893433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium554Open in IMG/M
3300031782|Ga0318552_10301812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49814Open in IMG/M
3300031798|Ga0318523_10386294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49696Open in IMG/M
3300031833|Ga0310917_10961556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei573Open in IMG/M
3300031866|Ga0316049_114504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300031941|Ga0310912_11168613Not Available586Open in IMG/M
3300032001|Ga0306922_10054721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4136Open in IMG/M
3300032063|Ga0318504_10197116Not Available939Open in IMG/M
3300032068|Ga0318553_10325906All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300032076|Ga0306924_11220571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300032094|Ga0318540_10406732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300033289|Ga0310914_10043828All Organisms → cellular organisms → Bacteria3657Open in IMG/M
3300034447|Ga0370544_16370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49583Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.72%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds3.15%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.94%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.57%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.57%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.57%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.57%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.57%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.79%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.79%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000660Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16EnvironmentalOpen in IMG/M
3300000699Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79EnvironmentalOpen in IMG/M
3300000701Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4EnvironmentalOpen in IMG/M
3300000725Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6EnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300001108Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3EnvironmentalOpen in IMG/M
3300001155Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1EnvironmentalOpen in IMG/M
3300001383Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300003569Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010101Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010854Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010855Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300019161Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019165Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019185Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019187Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021855Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023046Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MSEnvironmentalOpen in IMG/M
3300023656Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025481Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026860Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes)EnvironmentalOpen in IMG/M
3300026990Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030863Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030987Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031043Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031663Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031866Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034447Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12415J11908_1034433300000660Tropical Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD
JGI12536J11923_10363013300000699Tropical Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSX
JGI12340J11893_10039733300000701Tropical Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPDL*
JGI12588J11881_10336213300000725Tropical Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARV
AP72_2010_repI_A001DRAFT_105889713300000893Forest SoilMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRG
JGI12647J13326_10244533300001108Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPD
JGI12625J13251_1016813300001155Forest SoilMPVERRGQVTDVGSESTGNRRSSNSRREAAAFVRWHEPDD
JGI20194J14741_101181033300001383Arctic Peat SoilMPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSDSG*
JGI12053J15887_1041909313300001661Forest SoilMPVEQREQVIDAESEPTGDRMSSNSRRKAAAFVRWHEPDDARVSSPDL*AARGE
JGIcombinedJ26739_10108314013300002245Forest SoilMPAEQREQVIGVGSEPTGNRMSSNSRRKAAAFVRWHEPDDARVSSPDL*
JGI26346J50198_101486723300003351Bog Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAXVRWHEPDDARVSSP
Ga0007420J51693_103948823300003569Avena Fatua RhizosphereMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP
Ga0062384_10139461923300004082Bog Forest SoilMPVERRGQVTDVGSGPTGNRMSSNSRRKAAAFVRWHEPDDARVSSPD
Ga0066397_1007655133300004281Tropical Forest SoilMPAERRGQVIAVGIEPTGHRTSSISRRKAAAFKRWHEPDDARVSRPESVSGSG*
Ga0066395_1044933423300004633Tropical Forest SoilMPAEQRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSG
Ga0058861_1202039943300004800Host-AssociatedMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDLC
Ga0058860_1221335723300004801Host-AssociatedMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL*
Ga0066688_1022011023300005178SoilMPVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVSSPDL*
Ga0066685_1042833723300005180SoilMPVERRGQVTDVGSEPTGNRKSSNSRREAAAFVRWHEPDDARVSSPDL*
Ga0008090_1426532013300005363Tropical Rainforest SoilMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL
Ga0066687_1020797313300005454SoilSGVMPVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVSSPDL*
Ga0066707_1101712113300005556SoilMPVERRGQVTDVGSEPTGNSSNSRREAAAFVRWHEPDDARVSSPDL*
Ga0066694_1037494913300005574SoilMPVERRGQVTDVGSEPTGNRRSSNSQRKAAAFVRWHEPD
Ga0068864_10122504623300005618Switchgrass RhizosphereVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL
Ga0066905_10111340713300005713Tropical Forest SoilVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEP
Ga0066903_10513417313300005764Tropical Forest SoilVERRGWVTRAWIGEPTGNRRSSLIERKAAAFGEWHE
Ga0066903_10703203823300005764Tropical Forest SoilVMPVERRGWVTRAWIGEPTGNRRSSLIERKAAAFGEWHEPYKSRGLRTVL*
Ga0066794_1019221813300005947SoilMLVERRGQVTDVGSEPTGNRRSSNSRRKATAFAWWHEPDEARVSSPESVRG
Ga0075019_1078139313300006086WatershedsMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRW
Ga0070712_10181134413300006175Corn, Switchgrass And Miscanthus RhizosphereMPVERRGQVTDVGSESTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL*
Ga0079222_1045206423300006755Agricultural SoilMPVEQRGQVTDVGREPTGDRMSSNFRRKAAAFVSVARAG*
Ga0066797_120814313300006864SoilMPVEQRGQVTDVGSEPTGDRMSSNFRRKAAAFVSVARA
Ga0126380_1146749713300010043Tropical Forest SoilMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRW
Ga0126373_1128466413300010048Tropical Forest SoilRSGVIPVERRGQVTGVEIDRSTGNGMNRLSWRKAAAFTRWHEPDKLRGLCPVL*
Ga0127481_106271713300010101Grasslands SoilVERRGQVTDVGSEPTGNRKSSNSRREAAAFVRWHEPDDA
Ga0126318_1007076013300010152SoilVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSS
Ga0127503_1072224513300010154SoilVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVS
Ga0126370_1148085313300010358Tropical Forest SoilMPVERRGQVTDVESGPTGNRKSPISRREAAAFVRWHEPD
Ga0126378_1336036413300010361Tropical Forest SoilMPAEQSGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEP
Ga0126360_104180413300010854Boreal Forest SoilVEQREQVIDVGREPTGNRMSSKSRRKAAAFVRWHEPDDARVSR
Ga0126355_113118413300010855Boreal Forest SoilMPAEQREQVIGVGSEPTGNRMNSSSRRKAAAFVRWHEPDDMRVSSPD
Ga0126345_105263313300010858Boreal Forest SoilVERRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSP
Ga0126348_121496013300010862Boreal Forest SoilVEQREQVIDAESEPTGNRMSSNSRRKAAAFVSVARA
Ga0126346_118346913300010865Boreal Forest SoilMPVEQREQVIDAEIEPTGDRMSSKSRRKAAAFVRWHEPDDARVSSPD
Ga0150985_11625194213300012212Avena Fatua RhizosphereMPVEQRGQVTDVGSEPTGNRRSSDSRRKAAAFVRWHEPDDARVSSPDL
Ga0150985_11840764013300012212Avena Fatua RhizosphereVERRGQVTDVGSEPTGNRRSSNSRRKAAAFARWHEPDDARVSSPD
Ga0150984_10121111013300012469Avena Fatua RhizosphereVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDAR
Ga0137404_1201833413300012929Vadose Zone SoilEAGVMLVERRGQVIAVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSPDL*
Ga0126369_1187931513300012971Tropical Forest SoilSDEAGVMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL*
Ga0126369_1359663413300012971Tropical Forest SoilMGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSGRNS
Ga0164309_1079190813300012984SoilSGVMPVEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVSSPDL*
Ga0164309_1079190823300012984SoilVEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHE
Ga0163162_1161668413300013306Switchgrass RhizosphereERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL*
Ga0181532_1080985713300014164BogVEQREPVIDVGSGPTGNRMSSNSRRKAAAFARWHEPDDARVSSPESVRG
Ga0182041_1082666913300016294SoilMAVERRGQVTGVEIDRSTGNGRNHWSWRKAAAFTRWHEPDKLRG
Ga0182041_1216650813300016294SoilMPAERREQVIDVEIEPTGNRMSSMSQWKAAAFMRWHEPDDARVSRPE
Ga0184635_1021668113300018072Groundwater SedimentVEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDAR
Ga0184635_1021668123300018072Groundwater SedimentVEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARVSSPDL
Ga0184602_12646733300019161SoilMLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRV
Ga0184589_12631513300019165SoilMPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD
Ga0184587_12233623300019185SoilMLVERRGQVTDVGREPTANGRSSNSRLKAAAFARWHEPDDTRVS
Ga0184584_13070933300019187SoilMLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDDTRVSR
Ga0181502_118308623300019242PeatlandMPVEQREQVIDAGSGPTGNRMISNPRRKAAAFVRWHEP
Ga0187797_148015713300019284PeatlandVEQRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSP
Ga0187797_177269213300019284PeatlandMPVEQRGQVIDVGSEPTGDRRSSNSRRKAAAFNRWHEPDEARASCP
Ga0206356_1092989313300020070Corn, Switchgrass And Miscanthus RhizosphereVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS
Ga0179585_108391513300021307Vadose Zone SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDA
Ga0213881_1060033413300021374Exposed RockMPAEQRGQVIDVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSGRN
Ga0126371_1107515723300021560Tropical Forest SoilMGWVIDAEIRSTGNRKSLMSWRKAAAFKRWHEPDDARVSRPESV
Ga0213854_114194513300021855WatershedsMLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRVSRP
Ga0213854_134763023300021855WatershedsMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL
Ga0213851_134735013300021860WatershedsMPVERREQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP
Ga0213853_1097048513300021861WatershedsMPVEQREQVIDVGSEPTGNRMSSNSPRKAAAFVRWHEPDDARVSSP
Ga0222625_121381513300022195Groundwater SedimentVEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVSSP
Ga0233356_101758123300023046SoilMPAEQREQVIGVGSEPTGNRMSSNSRRKAAAFVRWHEPD
Ga0247547_10377423300023656SoilMLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDDTRVS
Ga0208821_106772613300025432PeatlandMLVERRGQVTDVGREPTGNGRSSNSRRKAAAFTAIIT
Ga0208850_100269943300025457Arctic Peat SoilMPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSDSG
Ga0208079_109679913300025481Arctic Peat SoilMLVEQRGQVTDVGSEPTGNRRSSNSRRKATAFAWWHEPDEARVSS
Ga0209124_1022509113300025852Arctic Peat SoilMPAEQRGQVIGVGKEPTVKGRSFKSQRKAAAFVRRHEPDDARVSRPESVSD
Ga0207688_1062374413300025901Corn, Switchgrass And Miscanthus RhizosphereMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSVRICERLGVK
Ga0207650_1114368913300025925Switchgrass RhizosphereMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSS
Ga0209880_107702813300026271SoilMPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVS
Ga0209438_118949513300026285Grasslands SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPDL
Ga0257155_105814413300026481SoilMPVERRGQATDVGSEPTGNRRSSNSRRKAAAFARWHEPDDA
Ga0257153_108244913300026490SoilVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDD
Ga0207823_11100513300026860Tropical Forest SoilVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARV
Ga0207824_103409223300026990Tropical Forest SoilMLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARGHEPDD
Ga0209729_103708413300027061Forest SoilMPAERRGQVIGVGKEPTVKGKSFKSQRKAAAFVRWHEPDDAR
Ga0208997_102781123300027181Forest SoilMPVERRGQVTDVESEPTGNRRSSDSRREAAAFVRWHEPDD
Ga0207826_110553513300027680Tropical Forest SoilMPVEQRGQVTDVGSEPTGNRRSSNSRRKAAAFAQWHEPDDARVSSPDVCPVKASMYSR
Ga0207826_116738513300027680Tropical Forest SoilMPAERRGQVIAVGIEPTGHRTSSISRRKAAAFKRWHEPDDARVSRPEAV
Ga0307312_1102862113300028828SoilVEQRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARV
Ga0311371_1184009413300029951PalsaVEQREQVIDAGSGPTGNRMSSNPRRKAAAFVRWHEPDDARVSSPDL
Ga0302183_1031936813300030509PalsaVEQREQVIDAGSGPTGNRMSSNPRRKAAAFVRWHEPDDARV
Ga0265462_1151000213300030738SoilMLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRVS
Ga0265763_100909123300030763SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS
Ga0265763_101352223300030763SoilMPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS
Ga0265766_101679813300030863SoilMPAEQREQVIGVGSEPTGNSMSSNSRRKAAAFVRWHEPDDARVS
Ga0308206_113822113300030903SoilVEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARVSSP
Ga0308155_103101213300030987SoilVEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVS
Ga0265773_101543823300031018SoilMLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPD
Ga0265779_11022413300031043SoilMPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP
Ga0308192_107838713300031082SoilVEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARV
Ga0308204_1016668213300031092SoilVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP
Ga0308195_107108213300031123SoilMPVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDES
Ga0307497_1066286913300031226SoilVERRGQVTDVGSESTGNRRSSNSRRKAAAFRRWHEPDDAR
Ga0318516_1043835913300031543SoilVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGL
Ga0318538_1051969413300031546SoilVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHE
Ga0307484_11375413300031663Hardwood Forest SoilMPAERRGQVIDVGSEPTDNRRSSNSRREAAAFIRWHEPDDARVSSPD
Ga0318561_1053047713300031679SoilMPAEQSGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRLDL
Ga0318561_1058411813300031679SoilVERRGQVTDVESEPTGNRRSSNSRRKAAAFAQWHEPDDARVSS
Ga0307477_1037891913300031753Hardwood Forest SoilMPVERRGQVTDVGSEPTGNRRSSNSRREAAVFARWHEPDDARVSRP
Ga0318508_122585513300031780SoilVERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGL
Ga0318547_1089343323300031781SoilMPAERREQVIDVEIEPTGNRMSSMSQWKAAAFMRWHEPDDAR
Ga0318552_1030181213300031782SoilMPTERREQVIDVEIEPTGNRTSSMFQRKAAAFIRWHEPDDARVSRPESVSGSG
Ga0318523_1038629413300031798SoilVERRGQVTDVGSEPTGNRRSSNSRRKAAAFARWHEPDDTRVSSPDLV
Ga0310917_1096155623300031833SoilVERRGQVTDVGSEPTGNRRSFNSRREAAAFVRWHEPDDARVSSPDL
Ga0316049_11450423300031866SoilMLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPD
Ga0310912_1116861313300031941SoilMAVERRGQVTGVEIDRSTGNGRNHWSWRKAAAFTR
Ga0306922_1005472113300032001SoilMPVERRGQITDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL
Ga0318504_1019711613300032063SoilMPVERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL
Ga0318553_1032590623300032068SoilVEPRGQVIDVETEPTGNRTSSIFQRKAAAFNRWHEPDKSRG
Ga0306924_1122057113300032076SoilVERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKS
Ga0318540_1040673223300032094SoilMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSR
Ga0310914_1004382813300033289SoilMPVKRRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPD
Ga0370544_16370_2_1333300034447SoilMEQRGQVTEVGSEPTGDRRSSNSRREAAAFVRWHEPDDARVSSP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.