NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001155

3300001155: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1



Overview

Basic Information
IMG/M Taxon OID3300001155 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0071004 | Gp0055282 | Ga0002898
Sample NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2520391
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2
All Organisms → cellular organisms → Bacteria4
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Multiple Locations In Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → land → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003899Metagenome / Metatranscriptome463Y
F026495Metagenome / Metatranscriptome197Y
F029122Metagenome / Metatranscriptome189N
F037452Metagenome / Metatranscriptome168Y
F041945Metagenome / Metatranscriptome159Y
F059929Metagenome / Metatranscriptome133Y
F060395Metagenome / Metatranscriptome133Y
F065994Metagenome / Metatranscriptome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12625J13251_10007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2222Open in IMG/M
JGI12625J13251_10019All Organisms → cellular organisms → Bacteria1981Open in IMG/M
JGI12625J13251_10132All Organisms → cellular organisms → Bacteria1202Open in IMG/M
JGI12625J13251_10135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1191Open in IMG/M
JGI12625J13251_10168Not Available1046Open in IMG/M
JGI12625J13251_10507All Organisms → cellular organisms → Bacteria589Open in IMG/M
JGI12625J13251_10548Not Available564Open in IMG/M
JGI12625J13251_10668All Organisms → cellular organisms → Bacteria507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12625J13251_10007JGI12625J13251_100071F037452MESSFLIEVDNTSILRTGALHCYHYTLNRLPAPRLLLPCSGLERSDFVQWP
JGI12625J13251_10019JGI12625J13251_100191F026495VFGVAAASRNTRFQAARYGLTWVGLAPTDRASFAWRLPSLDHRVGARKQGRRHLNA
JGI12625J13251_10132JGI12625J13251_101321F003899MTGFIVSVFPFRNRVSSKEAFEGLELGERKLSRPVLRGPGGRKVARLLGS
JGI12625J13251_10135JGI12625J13251_101351F029122MLIRPAIDDTDPIRYRRPTPDGQFSGNIIDEAMRPTIAW*
JGI12625J13251_10168JGI12625J13251_101681F065994MPVERRGQVTDVGSESTGNRRSSNSRREAAAFVRWHEPDD
JGI12625J13251_10507JGI12625J13251_105071F041945EMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR*
JGI12625J13251_10548JGI12625J13251_105481F059929MESSILSEVDDTSILRTGLPRRYACPLLATGLSPLAPRSGLERSDFVL
JGI12625J13251_10668JGI12625J13251_106681F060395PVGVGITIARDPLHGSGRAGFPHPALALGDNAHAAQRIGMTDRRQRQPASEEAMHASPEDVAVLAPPRQRAMPIPTNSESKHRQRRLVHGHSVVAKVSTHNRPQPLALIGDGFMHSSLKLGLHRVQLRLQSFADRLPKNRIHSVAPLLHADVRKTEEVERFRLPFSSP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.