NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025536

3300025536: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025536 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053062 | Gp0055522 | Ga0207952
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size207470306
Sequencing Scaffolds12
Novel Protein Genes12
Associated Families11

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → planetary subsurface zone → rock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015265Metagenome / Metatranscriptome256Y
F025322Metagenome / Metatranscriptome202Y
F028445Metagenome / Metatranscriptome191Y
F036355Metagenome / Metatranscriptome170Y
F046955Metagenome / Metatranscriptome150Y
F054174Metagenome / Metatranscriptome140Y
F055579Metagenome / Metatranscriptome138Y
F080249Metagenome / Metatranscriptome115Y
F089567Metagenome / Metatranscriptome109Y
F093899Metagenome106Y
F102792Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207952_1000023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales234886Open in IMG/M
Ga0207952_1000324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales43600Open in IMG/M
Ga0207952_1000445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales34077Open in IMG/M
Ga0207952_1000680All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus21896Open in IMG/M
Ga0207952_1000683All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus21879Open in IMG/M
Ga0207952_1003966All Organisms → Viruses → Predicted Viral4068Open in IMG/M
Ga0207952_1013552All Organisms → cellular organisms → Bacteria1710Open in IMG/M
Ga0207952_1030103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1015Open in IMG/M
Ga0207952_1039308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales854Open in IMG/M
Ga0207952_1044967All Organisms → cellular organisms → Bacteria784Open in IMG/M
Ga0207952_1046601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
Ga0207952_1063008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207952_1000023Ga0207952_1000023113F046955MAAPRQMTANTLNALKGWPQPAAVDYHTEFDPSITDVVLPGSVVHLNSDGFYELGVGAEPVMPLFMFNGSDDPDVRNEGGDPATEKGVWIPINPTGQAMALVAVGAYELVSTAFDKTGTYNPNDPLTSPLSGGNAGKLIVGTLYTHMIVGFVSRGVVDNGYGHDGLAFWPFPVFPTP
Ga0207952_1000324Ga0207952_100032442F025322MFDDVEGLDGEMKNIVALIDQVRGKLGDRFLRLELADHLAPKSTPFRVPSGLGAAIDKRIAPAGMDALNLFRAIRDVNKDVPDNPDKLDALVAAMGKLKQSLIPLTAEVAIQVGFK
Ga0207952_1000445Ga0207952_100044518F054174MAWTDLISGCFGFGTAPFATNRPDEDSAKEAISAAQAEGATKAEFAQVIAMYPRKYIKSDQLLRERIREDAGRLDRLWKVSPVN
Ga0207952_1000680Ga0207952_100068029F015265MFPDFVMKSSTMYPAHITKNPALIEKNAIVNRNNVGLPVFLNPISDIIPIVSPTKNPIRFNMFSSRNSNDGYRFINLIILIC
Ga0207952_1000683Ga0207952_100068329F015265MKSSTMYPAHITKNPALIEKNAIVNRNNVGLPVFLNPISDIIPIASPTKNPIRFNMFSRRNSNDGYRFINLIILIC
Ga0207952_1003966Ga0207952_10039668F036355MDAIKAGDRLTYNDGRPGHSGVQATVLSVNGSGMVVQFDDRADTTAIAFSDKAWMAYLKA
Ga0207952_1013552Ga0207952_10135523F089567MKRMPATETIQFQATPEFRRQLDAEAARLNLSLPAYILYLHARLSQGRDSARLDRHVRDVFGKHGELMRRLAQ
Ga0207952_1030103Ga0207952_10301033F102792MTETTITVIEAARNLADCVNRAHYQNTTFVFLQDGVPFARLV
Ga0207952_1039308Ga0207952_10393082F028445MQERVKVFTFVSGHGETIIEPTHENHINEWLSATKGQLTKVTQSESERPSVGHHVTVCIWYVPDEPLG
Ga0207952_1044967Ga0207952_10449672F080249MADDKKKVKEDRNLISFKENYEVNYAVNQLKKQFPDETKVDIKEALFDAAKQVSPSEGREKIMRLARKDLRD
Ga0207952_1046601Ga0207952_10466012F093899MAHIIEVERHSKAEACSFLDALFYSDSVSAIGHRPDGNKTRAVAVNWDEDESSEIDVKISAMISNSLDSGEDLDEIAAYCRVFPETVLYQPELFDN
Ga0207952_1063008Ga0207952_10630082F055579MSNDDYTHYVIWKDRVVGEARIIQKCNECISLALVKLGAGGPKQFTDYAFVENRTLVLKVEN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.