NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027436

3300027436: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3-11 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027436 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072059 | Ga0207493
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3-11 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10582528
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021340Metagenome219Y
F028554Metagenome / Metatranscriptome191N
F081936Metagenome / Metatranscriptome114N
F082749Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207493_100868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae617Open in IMG/M
Ga0207493_101394All Organisms → cellular organisms → Bacteria549Open in IMG/M
Ga0207493_101944All Organisms → cellular organisms → Archaea502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207493_100868Ga0207493_1008682F028554AIIVMAALTGLFFLAAFVTAGSFLSTDPQAMSSVSKVTQLPRTEGGEAASRVASIVVETDKKGRCEERRFDNRTGKMVSANYVNCDARLEPERDTTPSENINRERIRAILGAFKK
Ga0207493_101259Ga0207493_1012591F082749ESVDAAGKLGRKRLINHAMTLDAGLSLKGVRHDIDPVVSLPARPVPGMALMLVRFINHFEVLRRESLGQLFCDEIGGSHIARLGERSLPVNGYKQVLKASPVKAHNVRS
Ga0207493_101394Ga0207493_1013942F021340AIVTLFFVIVLGASLFLGTVMVIGTFHGVDPSNELTANGRAGRIARTLQDGTLCHYMIFDNKTAQTVEDRIGRCDENKPKPKQEKPATFTWGK
Ga0207493_101944Ga0207493_1019441F081936NAKKPSPPNVEASVNPKVEQLAHVLEITLIVVPDSADLLNFNFRFLIIYRLKFTKIATRTELIQVKINASIISLGT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.