NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027477

3300027477: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10.2A4w-11 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027477 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0091565 | Ga0207456
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10.2A4w-11 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27955499
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available5
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. Nb-311A1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004992Metagenome / Metatranscriptome416Y
F018027Metagenome / Metatranscriptome237Y
F022904Metagenome212Y
F024822Metagenome / Metatranscriptome204N
F061030Metagenome / Metatranscriptome132Y
F063305Metagenome / Metatranscriptome129N
F079360Metagenome / Metatranscriptome116N
F087420Metagenome / Metatranscriptome110Y
F101797Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207456_100341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria916Open in IMG/M
Ga0207456_101583Not Available660Open in IMG/M
Ga0207456_102572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
Ga0207456_102743Not Available581Open in IMG/M
Ga0207456_103144Not Available562Open in IMG/M
Ga0207456_103162Not Available561Open in IMG/M
Ga0207456_103331Not Available554Open in IMG/M
Ga0207456_103912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. Nb-311A532Open in IMG/M
Ga0207456_104044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207456_100341Ga0207456_1003411F061030CKDIFDKVACTCAVRNGGHVIPPPVGVRREGLKLRPKKEAGGTQTLDGGRVAFPKYYRREGLKFHRSRALEGYLACMRAAGRK
Ga0207456_101583Ga0207456_1015831F063305VSLRPVRSTESASGRVKPERRFVTRETARLLPIVVPVALSGFAVLAFAIGRFVASNPEPEVLAGVFALLLAATFVEAHPVPIEGISSEGISLAAVFIVGTAVIYGWAPAVVMGFLTRALIEMFQRRPAIRLS
Ga0207456_102572Ga0207456_1025721F004992MSNETPAAIDPDMFAAVFSQNWDNARHIKSERISFMNAYSVICAGVLALLQSVQASDLIRIALLFFMTLFSLVGLLTSLRLKSELEECLAKIEAMTVQAKVSQFVALGQLEGKPARYPRFRWIFPIFYTMTTAGFITLIVYRLVTGEAMK
Ga0207456_102743Ga0207456_1027431F022904MELTRTDSVPKGDTLSAYDFAMEEVTGASSRLADALLARTQKRADATTTEQECSNARSVYERMIHLFPRVRLDATQRASLLKELGLLRSRLEGCKAAEGKSQPT
Ga0207456_103144Ga0207456_1031441F101797LFQNQVDRRWFGPPGKCSTGLDVDTNVQNPKVSSIGAWGAEEVDRSRNQKIFDERRFAIRPTPVVQQSADAGGLIDRQGCKSDKSVPRNANVRILVQSGAWSSVDIDEDGNADGQVKTADLTSNLATMPPWG
Ga0207456_103162Ga0207456_1031622F079360MRRTLTVAAIAVLVFAGIAKLVAAPSRHAAGRDTSVQPTISTYDLHTGYRGMDTLPVAEIPQP
Ga0207456_103331Ga0207456_1033311F024822VRQLFIRVAGVILCALALSGCVDSAGPLLSEAQPVLGERLRLQFYSLSKGTADEPEQATYKWDRGTYQRTGGGMTDIGSFSVHPLARDIFVVQSASAKRPGMFEYAIARRLVDGVYQVIAVDEADAGQVTRARFCKRASDSSCRIEKRDQLY
Ga0207456_103912Ga0207456_1039121F087420MGPKLGTRAKRSATGVAIALALSALPHTPASAAKPPYGSCVAVTKQEYDSAKKQHMLQTRYTQYVRT
Ga0207456_104044Ga0207456_1040441F018027MKARDFKGYYDGHKDTFLVTDVSNKAQARALHVNFSREIGKVKSAPAQYFVRGKAVRGQLSVFGSEPGEADYNPLWEEFYVSWNPGVTPVLLVKDDQITALAKSKKLTLKDARIVLNAPITKVGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.