NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300034685

3300034685: Fracking water microbial communities from deep shales in Oklahoma, United States - K-7-5



Overview

Basic Information
IMG/M Taxon OID3300034685 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118431 | Gp0324339 | Ga0310149
Sample NameFracking water microbial communities from deep shales in Oklahoma, United States - K-7-5
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size245194943
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSubsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → planetary subsurface zone → fracking liquid
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Oklahoma
CoordinatesLat. (o)35.812Long. (o)-98.262Alt. (m)N/ADepth (m)2943
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077200Metagenome / Metatranscriptome117N
F101010Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0310149_000949Not Available25788Open in IMG/M
Ga0310149_008497All Organisms → cellular organisms → Bacteria4447Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0310149_000949Ga0310149_000949_17132_17464F101010MILFNNIYATVWSVEDKGNYVKGRISTSEKNKEGEYVNSNWFVTFVGKAKEPALALSTRDRIKIISGKISNTTTGEGKDKKSFVNVVIFDFENLSNSQNESNDNFDDLPF
Ga0310149_008497Ga0310149_008497_157_918F077200MMNKFTVIDVKTQPNIERIKEYAQRYGMTLEEAIERKRIGGDYFPIRDQEIVSVGILNFVHNNEDKASIMATVFTGEEKKVLDATAEKLEKIVKATGKPFFITGDGRKYALELLAGRAMAYMIEAKKEDQEISPELQNMIRIITNPKHGYLKPFDTRDSIDMQAVFGLGNGVIPLPKELQYKNEDLPRLAEETKRILLDMTKNYACYIEAQGEKMKPVIYKLDEKIFKTAEIFEFEETKAKNEEEMEEKIDGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.