Scaffold JGI11931J13222_1002647

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11931J13222_1002647

Scaffold JGI11931J13222_1002647

Overview

Basic Information
Taxon OID	3300001125 Open in IMG/M
Scaffold ID	JGI11931J13222_1002647 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Atlantic Ocean - MP0204
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1971
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	South of Cape Verde, Atlantic Ocean
Coordinates	Lat. (^o)	7.33	Long. (^o)	-26.0	Alt. (m)		Depth (m)	4002.51
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076187	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11931J13222_10026476	F076187	N/A	MPDCINPALTVSVIICPDGLVSLAITHFFEFISXEKFFENFKTSRNVKSFPKIPLIPDTDIFNASNLDTLFINSERKWLVPR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.