Scaffold Ga0129308_1016728

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129308_1016728

Scaffold Ga0129308_1016728

Overview

Basic Information
Taxon OID	3300010280 Open in IMG/M
Scaffold ID	Ga0129308_1016728 Open in IMG/M
Source Dataset Name	Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2107
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.07	Long. (^o)	-89.4	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076064	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129308_10167283	F076064	N/A	LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPKPALKFY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.