NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186446_113626

Scaffold Ga0186446_113626


Overview

Basic Information
Taxon OID3300017113 Open in IMG/M
Scaffold IDGa0186446_113626 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Great South Bay, New York in GSe medium with ammonium, 22 C, 32 psu salinity and 177 ?mol photons light - Aureococcus anophagefferens CCMP 1850 (MMETSP0915)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)567
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameUSA: Great South Bay, Long Island, New York
CoordinatesLat. (o)40.6508Long. (o)-73.1524Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066421Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0186446_1136261F066421N/ASGPNCGPGKAHQYYNTQSDWDSSCSTRVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.