Basic Information | |
---|---|
Family ID | F000792 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 890 |
Average Sequence Length | 38 residues |
Representative Sequence | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Number of Associated Samples | 222 |
Number of Associated Scaffolds | 890 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 56.98 % |
% of genes near scaffold ends (potentially truncated) | 40.45 % |
% of genes from short scaffolds (< 2000 bps) | 87.30 % |
Associated GOLD sequencing projects | 203 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.921 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.270 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.303 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.067 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 890 Family Scaffolds |
---|---|---|
PF01068 | DNA_ligase_A_M | 2.70 |
PF04392 | ABC_sub_bind | 2.02 |
PF03401 | TctC | 0.90 |
PF01381 | HTH_3 | 0.90 |
PF03734 | YkuD | 0.90 |
PF00196 | GerE | 0.79 |
PF00239 | Resolvase | 0.67 |
PF07883 | Cupin_2 | 0.67 |
PF01494 | FAD_binding_3 | 0.45 |
PF02518 | HATPase_c | 0.45 |
PF01527 | HTH_Tnp_1 | 0.45 |
PF04519 | Bactofilin | 0.45 |
PF13185 | GAF_2 | 0.45 |
PF00072 | Response_reg | 0.34 |
PF00872 | Transposase_mut | 0.34 |
PF12727 | PBP_like | 0.34 |
PF13676 | TIR_2 | 0.34 |
PF01116 | F_bP_aldolase | 0.34 |
PF00589 | Phage_integrase | 0.34 |
PF00582 | Usp | 0.22 |
PF01019 | G_glu_transpept | 0.22 |
PF14559 | TPR_19 | 0.22 |
PF07508 | Recombinase | 0.22 |
PF02894 | GFO_IDH_MocA_C | 0.22 |
PF06411 | HdeA | 0.22 |
PF10129 | OpgC_C | 0.22 |
PF14235 | DUF4337 | 0.22 |
PF00313 | CSD | 0.22 |
PF13683 | rve_3 | 0.22 |
PF13505 | OMP_b-brl | 0.22 |
PF13432 | TPR_16 | 0.22 |
PF07885 | Ion_trans_2 | 0.22 |
PF08450 | SGL | 0.22 |
PF12728 | HTH_17 | 0.22 |
PF00126 | HTH_1 | 0.22 |
PF00034 | Cytochrom_C | 0.22 |
PF04313 | HSDR_N | 0.22 |
PF13412 | HTH_24 | 0.11 |
PF02775 | TPP_enzyme_C | 0.11 |
PF14067 | LssY_C | 0.11 |
PF06035 | Peptidase_C93 | 0.11 |
PF05036 | SPOR | 0.11 |
PF01548 | DEDD_Tnp_IS110 | 0.11 |
PF13202 | EF-hand_5 | 0.11 |
PF00550 | PP-binding | 0.11 |
PF17172 | GST_N_4 | 0.11 |
PF07369 | DUF1488 | 0.11 |
PF03703 | bPH_2 | 0.11 |
PF00052 | Laminin_B | 0.11 |
PF00174 | Oxidored_molyb | 0.11 |
PF00535 | Glycos_transf_2 | 0.11 |
PF12706 | Lactamase_B_2 | 0.11 |
PF04352 | ProQ | 0.11 |
PF02796 | HTH_7 | 0.11 |
PF05876 | GpA_ATPase | 0.11 |
PF02746 | MR_MLE_N | 0.11 |
PF07662 | Nucleos_tra2_C | 0.11 |
PF00881 | Nitroreductase | 0.11 |
PF08734 | GYD | 0.11 |
PF09866 | DUF2093 | 0.11 |
PF13191 | AAA_16 | 0.11 |
PF03174 | CHB_HEX_C | 0.11 |
PF13489 | Methyltransf_23 | 0.11 |
PF00583 | Acetyltransf_1 | 0.11 |
PF07859 | Abhydrolase_3 | 0.11 |
PF00903 | Glyoxalase | 0.11 |
PF07045 | DUF1330 | 0.11 |
PF09361 | Phasin_2 | 0.11 |
PF00654 | Voltage_CLC | 0.11 |
PF01022 | HTH_5 | 0.11 |
PF12850 | Metallophos_2 | 0.11 |
PF10431 | ClpB_D2-small | 0.11 |
PF00346 | Complex1_49kDa | 0.11 |
PF10968 | DUF2770 | 0.11 |
PF05593 | RHS_repeat | 0.11 |
PF01710 | HTH_Tnp_IS630 | 0.11 |
PF01042 | Ribonuc_L-PSP | 0.11 |
PF03060 | NMO | 0.11 |
PF03237 | Terminase_6N | 0.11 |
PF00848 | Ring_hydroxyl_A | 0.11 |
PF00656 | Peptidase_C14 | 0.11 |
PF13405 | EF-hand_6 | 0.11 |
PF00296 | Bac_luciferase | 0.11 |
PF01066 | CDP-OH_P_transf | 0.11 |
PF12844 | HTH_19 | 0.11 |
PF05063 | MT-A70 | 0.11 |
PF04402 | SIMPL | 0.11 |
PF01230 | HIT | 0.11 |
COG ID | Name | Functional Category | % Frequency in 890 Family Scaffolds |
---|---|---|---|
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.70 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.70 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.02 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.90 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.90 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.90 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.67 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.45 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.45 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.45 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.45 |
COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.34 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.34 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.22 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.22 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.22 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.22 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.22 |
COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.11 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.11 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.11 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.11 |
COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.11 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.11 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.11 |
COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.11 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.11 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.11 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.11 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.11 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.11 |
COG3109 | sRNA-binding protein ProQ | Signal transduction mechanisms [T] | 0.11 |
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.11 |
COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.11 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.11 |
COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.11 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.11 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.11 |
COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.11 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.11 |
COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.11 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.11 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.11 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.11 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.11 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.11 |
COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.11 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.92 % |
All Organisms | root | All Organisms | 47.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16751335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4667 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig533464 | Not Available | 531 | Open in IMG/M |
2170459004|F62QY1Z01AZBZR | Not Available | 505 | Open in IMG/M |
2170459005|F1BAP7Q02GPJ3N | Not Available | 524 | Open in IMG/M |
2170459024|GZTSFBX01DV784 | Not Available | 501 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10910415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 755 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1009038 | Not Available | 1650 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1055385 | Not Available | 580 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1069162 | Not Available | 522 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1005263 | Not Available | 2094 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1017121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1159 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1017406 | Not Available | 1149 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1055135 | Not Available | 609 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10007554 | Not Available | 2995 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10015600 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10017100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1993 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10019241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1877 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10027166 | Not Available | 1554 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10032195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1412 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10038888 | Not Available | 1264 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10070975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10086497 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10090010 | Not Available | 762 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10092347 | Not Available | 751 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10104078 | Not Available | 698 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10115745 | Not Available | 656 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10157432 | Not Available | 544 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10164298 | Not Available | 530 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10175786 | Not Available | 508 | Open in IMG/M |
3300000651|AP72_2010_repI_A10DRAFT_1038668 | Not Available | 619 | Open in IMG/M |
3300000651|AP72_2010_repI_A10DRAFT_1039035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1029976 | Not Available | 1006 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1035285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1076821 | Not Available | 587 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1095943 | Not Available | 520 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10057640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10072828 | Not Available | 740 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10074620 | Not Available | 729 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10089847 | Not Available | 652 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10101869 | Not Available | 606 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10135098 | Not Available | 513 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1034691 | Not Available | 709 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1047930 | Not Available | 603 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1020453 | Not Available | 1074 | Open in IMG/M |
3300000955|JGI1027J12803_104948131 | Not Available | 612 | Open in IMG/M |
3300000956|JGI10216J12902_103182752 | Not Available | 829 | Open in IMG/M |
3300001867|JGI12627J18819_10082155 | Not Available | 1337 | Open in IMG/M |
3300001867|JGI12627J18819_10097716 | Not Available | 1213 | Open in IMG/M |
3300004633|Ga0066395_10068883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1623 | Open in IMG/M |
3300004633|Ga0066395_10266977 | Not Available | 923 | Open in IMG/M |
3300004633|Ga0066395_10291403 | Not Available | 889 | Open in IMG/M |
3300004633|Ga0066395_10319301 | Not Available | 854 | Open in IMG/M |
3300004633|Ga0066395_10369120 | Not Available | 802 | Open in IMG/M |
3300004633|Ga0066395_10812737 | Not Available | 562 | Open in IMG/M |
3300005181|Ga0066678_11112079 | Not Available | 508 | Open in IMG/M |
3300005184|Ga0066671_10038338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2323 | Open in IMG/M |
3300005332|Ga0066388_100231139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2482 | Open in IMG/M |
3300005332|Ga0066388_100466181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1903 | Open in IMG/M |
3300005332|Ga0066388_100516391 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1829 | Open in IMG/M |
3300005332|Ga0066388_100717424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
3300005332|Ga0066388_100728792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. HW608 | 1594 | Open in IMG/M |
3300005332|Ga0066388_100781352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1550 | Open in IMG/M |
3300005332|Ga0066388_101257965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1271 | Open in IMG/M |
3300005332|Ga0066388_101600122 | Not Available | 1146 | Open in IMG/M |
3300005332|Ga0066388_101613225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
3300005332|Ga0066388_101749899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1102 | Open in IMG/M |
3300005332|Ga0066388_102427803 | Not Available | 951 | Open in IMG/M |
3300005332|Ga0066388_102907141 | Not Available | 875 | Open in IMG/M |
3300005332|Ga0066388_102936075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
3300005332|Ga0066388_103527403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 799 | Open in IMG/M |
3300005332|Ga0066388_103528902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300005332|Ga0066388_103680209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
3300005332|Ga0066388_104282264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300005332|Ga0066388_104380709 | Not Available | 719 | Open in IMG/M |
3300005332|Ga0066388_104531932 | Not Available | 707 | Open in IMG/M |
3300005332|Ga0066388_105155095 | Not Available | 663 | Open in IMG/M |
3300005332|Ga0066388_106094534 | Not Available | 609 | Open in IMG/M |
3300005332|Ga0066388_106366647 | Not Available | 595 | Open in IMG/M |
3300005332|Ga0066388_108145543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300005332|Ga0066388_108175390 | Not Available | 522 | Open in IMG/M |
3300005332|Ga0066388_108232714 | Not Available | 520 | Open in IMG/M |
3300005363|Ga0008090_10037107 | Not Available | 801 | Open in IMG/M |
3300005363|Ga0008090_10044458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1830 | Open in IMG/M |
3300005363|Ga0008090_10061588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1034 | Open in IMG/M |
3300005363|Ga0008090_10258595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2031 | Open in IMG/M |
3300005363|Ga0008090_15865355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
3300005436|Ga0070713_101014458 | Not Available | 801 | Open in IMG/M |
3300005447|Ga0066689_10643220 | Not Available | 666 | Open in IMG/M |
3300005467|Ga0070706_100284369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 1543 | Open in IMG/M |
3300005536|Ga0070697_100604773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
3300005549|Ga0070704_100549279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
3300005556|Ga0066707_10690187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
3300005557|Ga0066704_10624101 | Not Available | 689 | Open in IMG/M |
3300005557|Ga0066704_10760389 | Not Available | 605 | Open in IMG/M |
3300005569|Ga0066705_10028101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2995 | Open in IMG/M |
3300005586|Ga0066691_10694258 | Not Available | 602 | Open in IMG/M |
3300005598|Ga0066706_10812797 | Not Available | 736 | Open in IMG/M |
3300005713|Ga0066905_100080318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2140 | Open in IMG/M |
3300005713|Ga0066905_100112759 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300005713|Ga0066905_100124809 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300005713|Ga0066905_100140784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1720 | Open in IMG/M |
3300005713|Ga0066905_100147597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1688 | Open in IMG/M |
3300005713|Ga0066905_100150963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1673 | Open in IMG/M |
3300005713|Ga0066905_100202882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1484 | Open in IMG/M |
3300005713|Ga0066905_100224599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1423 | Open in IMG/M |
3300005713|Ga0066905_100227040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1417 | Open in IMG/M |
3300005713|Ga0066905_100280814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1297 | Open in IMG/M |
3300005713|Ga0066905_100322090 | Not Available | 1223 | Open in IMG/M |
3300005713|Ga0066905_100344367 | Not Available | 1188 | Open in IMG/M |
3300005713|Ga0066905_100386669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
3300005713|Ga0066905_100417963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
3300005713|Ga0066905_100519302 | Not Available | 994 | Open in IMG/M |
3300005713|Ga0066905_100531837 | Not Available | 983 | Open in IMG/M |
3300005713|Ga0066905_100555944 | Not Available | 964 | Open in IMG/M |
3300005713|Ga0066905_100572453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
3300005713|Ga0066905_100584964 | Not Available | 942 | Open in IMG/M |
3300005713|Ga0066905_100596531 | Not Available | 934 | Open in IMG/M |
3300005713|Ga0066905_100658595 | Not Available | 894 | Open in IMG/M |
3300005713|Ga0066905_100682483 | Not Available | 879 | Open in IMG/M |
3300005713|Ga0066905_100689284 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300005713|Ga0066905_100765389 | Not Available | 834 | Open in IMG/M |
3300005713|Ga0066905_101051689 | Not Available | 720 | Open in IMG/M |
3300005713|Ga0066905_101135948 | Not Available | 695 | Open in IMG/M |
3300005713|Ga0066905_101143262 | Not Available | 693 | Open in IMG/M |
3300005713|Ga0066905_101145810 | Not Available | 693 | Open in IMG/M |
3300005713|Ga0066905_101160482 | Not Available | 689 | Open in IMG/M |
3300005713|Ga0066905_101179932 | Not Available | 683 | Open in IMG/M |
3300005713|Ga0066905_101339238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300005713|Ga0066905_101421981 | Not Available | 629 | Open in IMG/M |
3300005713|Ga0066905_101422854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 628 | Open in IMG/M |
3300005713|Ga0066905_101682003 | Not Available | 583 | Open in IMG/M |
3300005713|Ga0066905_101714774 | Not Available | 577 | Open in IMG/M |
3300005713|Ga0066905_101715556 | Not Available | 577 | Open in IMG/M |
3300005713|Ga0066905_101774280 | Not Available | 569 | Open in IMG/M |
3300005713|Ga0066905_101837293 | Not Available | 559 | Open in IMG/M |
3300005713|Ga0066905_101932287 | Not Available | 546 | Open in IMG/M |
3300005713|Ga0066905_101947954 | Not Available | 544 | Open in IMG/M |
3300005713|Ga0066905_102018815 | Not Available | 535 | Open in IMG/M |
3300005713|Ga0066905_102042096 | Not Available | 532 | Open in IMG/M |
3300005713|Ga0066905_102245458 | Not Available | 509 | Open in IMG/M |
3300005764|Ga0066903_100008742 | All Organisms → cellular organisms → Bacteria | 9404 | Open in IMG/M |
3300005764|Ga0066903_100024309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6605 | Open in IMG/M |
3300005764|Ga0066903_100092263 | All Organisms → cellular organisms → Bacteria | 4034 | Open in IMG/M |
3300005764|Ga0066903_100101028 | Not Available | 3897 | Open in IMG/M |
3300005764|Ga0066903_100112600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3740 | Open in IMG/M |
3300005764|Ga0066903_100230806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2822 | Open in IMG/M |
3300005764|Ga0066903_100239060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 2783 | Open in IMG/M |
3300005764|Ga0066903_100256620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2706 | Open in IMG/M |
3300005764|Ga0066903_100261279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2687 | Open in IMG/M |
3300005764|Ga0066903_100292688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2566 | Open in IMG/M |
3300005764|Ga0066903_100398620 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
3300005764|Ga0066903_100493313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 2071 | Open in IMG/M |
3300005764|Ga0066903_100499638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2060 | Open in IMG/M |
3300005764|Ga0066903_100538090 | Not Available | 1997 | Open in IMG/M |
3300005764|Ga0066903_100581338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1933 | Open in IMG/M |
3300005764|Ga0066903_100617535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1884 | Open in IMG/M |
3300005764|Ga0066903_100642916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1852 | Open in IMG/M |
3300005764|Ga0066903_100703337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1782 | Open in IMG/M |
3300005764|Ga0066903_100712442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1772 | Open in IMG/M |
3300005764|Ga0066903_100718307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1766 | Open in IMG/M |
3300005764|Ga0066903_100726817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1757 | Open in IMG/M |
3300005764|Ga0066903_100733483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
3300005764|Ga0066903_100766586 | Not Available | 1717 | Open in IMG/M |
3300005764|Ga0066903_100833087 | Not Available | 1656 | Open in IMG/M |
3300005764|Ga0066903_100846200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1645 | Open in IMG/M |
3300005764|Ga0066903_100954626 | Not Available | 1560 | Open in IMG/M |
3300005764|Ga0066903_100957132 | Not Available | 1558 | Open in IMG/M |
3300005764|Ga0066903_100961428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1555 | Open in IMG/M |
3300005764|Ga0066903_101033455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1506 | Open in IMG/M |
3300005764|Ga0066903_101123181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
3300005764|Ga0066903_101185688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1416 | Open in IMG/M |
3300005764|Ga0066903_101352810 | Not Available | 1334 | Open in IMG/M |
3300005764|Ga0066903_101372644 | Not Available | 1325 | Open in IMG/M |
3300005764|Ga0066903_101393910 | Not Available | 1316 | Open in IMG/M |
3300005764|Ga0066903_101631338 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300005764|Ga0066903_101667685 | Not Available | 1212 | Open in IMG/M |
3300005764|Ga0066903_101713144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1197 | Open in IMG/M |
3300005764|Ga0066903_101737130 | Not Available | 1189 | Open in IMG/M |
3300005764|Ga0066903_101861983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1151 | Open in IMG/M |
3300005764|Ga0066903_101903706 | Not Available | 1139 | Open in IMG/M |
3300005764|Ga0066903_101983994 | Not Available | 1117 | Open in IMG/M |
3300005764|Ga0066903_102010397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1110 | Open in IMG/M |
3300005764|Ga0066903_102213355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
3300005764|Ga0066903_102226980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1057 | Open in IMG/M |
3300005764|Ga0066903_102472566 | Not Available | 1005 | Open in IMG/M |
3300005764|Ga0066903_102493123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
3300005764|Ga0066903_102519090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
3300005764|Ga0066903_102619864 | Not Available | 977 | Open in IMG/M |
3300005764|Ga0066903_102721866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
3300005764|Ga0066903_102786815 | Not Available | 948 | Open in IMG/M |
3300005764|Ga0066903_102865699 | Not Available | 935 | Open in IMG/M |
3300005764|Ga0066903_102954276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 921 | Open in IMG/M |
3300005764|Ga0066903_102959991 | Not Available | 920 | Open in IMG/M |
3300005764|Ga0066903_102960673 | Not Available | 920 | Open in IMG/M |
3300005764|Ga0066903_102993698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
3300005764|Ga0066903_103508122 | Not Available | 845 | Open in IMG/M |
3300005764|Ga0066903_103515407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 844 | Open in IMG/M |
3300005764|Ga0066903_103521877 | Not Available | 844 | Open in IMG/M |
3300005764|Ga0066903_103590539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 835 | Open in IMG/M |
3300005764|Ga0066903_103649851 | Not Available | 828 | Open in IMG/M |
3300005764|Ga0066903_103693461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
3300005764|Ga0066903_103902609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
3300005764|Ga0066903_104019245 | Not Available | 788 | Open in IMG/M |
3300005764|Ga0066903_104068178 | Not Available | 783 | Open in IMG/M |
3300005764|Ga0066903_104267913 | Not Available | 764 | Open in IMG/M |
3300005764|Ga0066903_104288175 | Not Available | 762 | Open in IMG/M |
3300005764|Ga0066903_104310078 | Not Available | 760 | Open in IMG/M |
3300005764|Ga0066903_104400081 | Not Available | 752 | Open in IMG/M |
3300005764|Ga0066903_104411453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300005764|Ga0066903_104432396 | Not Available | 749 | Open in IMG/M |
3300005764|Ga0066903_104455762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
3300005764|Ga0066903_104478947 | Not Available | 745 | Open in IMG/M |
3300005764|Ga0066903_104538311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
3300005764|Ga0066903_104621303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
3300005764|Ga0066903_104753223 | Not Available | 722 | Open in IMG/M |
3300005764|Ga0066903_104793691 | Not Available | 719 | Open in IMG/M |
3300005764|Ga0066903_104806507 | Not Available | 718 | Open in IMG/M |
3300005764|Ga0066903_104891817 | Not Available | 712 | Open in IMG/M |
3300005764|Ga0066903_105026654 | Not Available | 701 | Open in IMG/M |
3300005764|Ga0066903_105301116 | Not Available | 681 | Open in IMG/M |
3300005764|Ga0066903_105417522 | Not Available | 673 | Open in IMG/M |
3300005764|Ga0066903_105581750 | Not Available | 662 | Open in IMG/M |
3300005764|Ga0066903_105787336 | Not Available | 649 | Open in IMG/M |
3300005764|Ga0066903_105801424 | Not Available | 648 | Open in IMG/M |
3300005764|Ga0066903_105836133 | Not Available | 646 | Open in IMG/M |
3300005764|Ga0066903_105968055 | Not Available | 638 | Open in IMG/M |
3300005764|Ga0066903_106695054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300005764|Ga0066903_107008091 | Not Available | 584 | Open in IMG/M |
3300005764|Ga0066903_107098333 | Not Available | 580 | Open in IMG/M |
3300005764|Ga0066903_107139510 | Not Available | 578 | Open in IMG/M |
3300005764|Ga0066903_107750815 | Not Available | 552 | Open in IMG/M |
3300005764|Ga0066903_108076606 | Not Available | 539 | Open in IMG/M |
3300005764|Ga0066903_108230269 | Not Available | 533 | Open in IMG/M |
3300005764|Ga0066903_108973226 | Not Available | 506 | Open in IMG/M |
3300005764|Ga0066903_109091258 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005764|Ga0066903_109122410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
3300005764|Ga0066903_109151492 | Not Available | 500 | Open in IMG/M |
3300006028|Ga0070717_10026714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4608 | Open in IMG/M |
3300006028|Ga0070717_10060544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3135 | Open in IMG/M |
3300006028|Ga0070717_10090187 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300006028|Ga0070717_10456979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
3300006028|Ga0070717_11222588 | Not Available | 684 | Open in IMG/M |
3300006028|Ga0070717_11888933 | Not Available | 539 | Open in IMG/M |
3300006028|Ga0070717_11962798 | Not Available | 528 | Open in IMG/M |
3300006032|Ga0066696_10471792 | Not Available | 823 | Open in IMG/M |
3300006038|Ga0075365_10267986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
3300006046|Ga0066652_100292035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
3300006046|Ga0066652_100940221 | Not Available | 823 | Open in IMG/M |
3300006050|Ga0075028_100048694 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300006163|Ga0070715_10032504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2126 | Open in IMG/M |
3300006172|Ga0075018_10862046 | Not Available | 501 | Open in IMG/M |
3300006173|Ga0070716_100304873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1109 | Open in IMG/M |
3300006175|Ga0070712_100036737 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3335 | Open in IMG/M |
3300006175|Ga0070712_100045063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3044 | Open in IMG/M |
3300006175|Ga0070712_100065693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2576 | Open in IMG/M |
3300006755|Ga0079222_11555964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300006755|Ga0079222_11946560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
3300006797|Ga0066659_10142153 | Not Available | 1695 | Open in IMG/M |
3300006797|Ga0066659_10515275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
3300006845|Ga0075421_101478115 | Not Available | 744 | Open in IMG/M |
3300006852|Ga0075433_11434372 | Not Available | 597 | Open in IMG/M |
3300006854|Ga0075425_101516839 | Not Available | 757 | Open in IMG/M |
3300006854|Ga0075425_102581263 | Not Available | 562 | Open in IMG/M |
3300006854|Ga0075425_102665679 | Not Available | 552 | Open in IMG/M |
3300006871|Ga0075434_101037725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
3300006871|Ga0075434_101294481 | Not Available | 740 | Open in IMG/M |
3300006871|Ga0075434_101592516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300006871|Ga0075434_101872689 | Not Available | 606 | Open in IMG/M |
3300006904|Ga0075424_102453718 | Not Available | 547 | Open in IMG/M |
3300009012|Ga0066710_100657685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1595 | Open in IMG/M |
3300009094|Ga0111539_10912579 | Not Available | 1021 | Open in IMG/M |
3300009100|Ga0075418_12096319 | Not Available | 616 | Open in IMG/M |
3300009147|Ga0114129_11352067 | Not Available | 881 | Open in IMG/M |
3300009147|Ga0114129_12684723 | Not Available | 593 | Open in IMG/M |
3300009162|Ga0075423_10619162 | Not Available | 1141 | Open in IMG/M |
3300009162|Ga0075423_12388096 | Not Available | 576 | Open in IMG/M |
3300009176|Ga0105242_13084904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 516 | Open in IMG/M |
3300009176|Ga0105242_13316581 | Not Available | 501 | Open in IMG/M |
3300009792|Ga0126374_10042007 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300009792|Ga0126374_10047178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2158 | Open in IMG/M |
3300009792|Ga0126374_10048581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2135 | Open in IMG/M |
3300009792|Ga0126374_10309749 | Not Available | 1063 | Open in IMG/M |
3300009792|Ga0126374_10417668 | Not Available | 943 | Open in IMG/M |
3300009792|Ga0126374_10436026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 926 | Open in IMG/M |
3300009792|Ga0126374_10536103 | Not Available | 851 | Open in IMG/M |
3300009792|Ga0126374_11043277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 644 | Open in IMG/M |
3300009792|Ga0126374_11372984 | Not Available | 574 | Open in IMG/M |
3300010043|Ga0126380_10121979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1612 | Open in IMG/M |
3300010043|Ga0126380_10619154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300010043|Ga0126380_10705716 | Not Available | 812 | Open in IMG/M |
3300010043|Ga0126380_10922503 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300010043|Ga0126380_10972869 | Not Available | 712 | Open in IMG/M |
3300010043|Ga0126380_11084626 | Not Available | 681 | Open in IMG/M |
3300010043|Ga0126380_11156729 | Not Available | 664 | Open in IMG/M |
3300010043|Ga0126380_11860826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 546 | Open in IMG/M |
3300010043|Ga0126380_11998707 | Not Available | 530 | Open in IMG/M |
3300010046|Ga0126384_10008695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6259 | Open in IMG/M |
3300010046|Ga0126384_10086341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2276 | Open in IMG/M |
3300010046|Ga0126384_10172730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1685 | Open in IMG/M |
3300010046|Ga0126384_10210745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1545 | Open in IMG/M |
3300010046|Ga0126384_10269980 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300010046|Ga0126384_10320133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1282 | Open in IMG/M |
3300010046|Ga0126384_10326188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1271 | Open in IMG/M |
3300010046|Ga0126384_10356196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1221 | Open in IMG/M |
3300010046|Ga0126384_10540582 | Not Available | 1011 | Open in IMG/M |
3300010046|Ga0126384_10558595 | Not Available | 996 | Open in IMG/M |
3300010046|Ga0126384_10699101 | Not Available | 898 | Open in IMG/M |
3300010046|Ga0126384_10743429 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300010046|Ga0126384_10755959 | Not Available | 866 | Open in IMG/M |
3300010046|Ga0126384_10788385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
3300010046|Ga0126384_10892255 | Not Available | 802 | Open in IMG/M |
3300010046|Ga0126384_10943734 | Not Available | 782 | Open in IMG/M |
3300010046|Ga0126384_11188862 | Not Available | 703 | Open in IMG/M |
3300010046|Ga0126384_11257337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300010046|Ga0126384_11573717 | Not Available | 618 | Open in IMG/M |
3300010046|Ga0126384_11903041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 567 | Open in IMG/M |
3300010046|Ga0126384_12041309 | Not Available | 549 | Open in IMG/M |
3300010046|Ga0126384_12081040 | Not Available | 544 | Open in IMG/M |
3300010046|Ga0126384_12403875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300010046|Ga0126384_12423824 | Not Available | 508 | Open in IMG/M |
3300010047|Ga0126382_10146717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1608 | Open in IMG/M |
3300010047|Ga0126382_10329044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
3300010047|Ga0126382_10681695 | Not Available | 859 | Open in IMG/M |
3300010047|Ga0126382_10993758 | Not Available | 735 | Open in IMG/M |
3300010047|Ga0126382_11472252 | Not Available | 625 | Open in IMG/M |
3300010047|Ga0126382_11583390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300010047|Ga0126382_11829719 | Not Available | 572 | Open in IMG/M |
3300010047|Ga0126382_12386559 | Not Available | 513 | Open in IMG/M |
3300010048|Ga0126373_10604944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1149 | Open in IMG/M |
3300010048|Ga0126373_11094158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
3300010048|Ga0126373_11130045 | Not Available | 849 | Open in IMG/M |
3300010048|Ga0126373_11345880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
3300010048|Ga0126373_12386458 | Not Available | 589 | Open in IMG/M |
3300010048|Ga0126373_12662280 | Not Available | 558 | Open in IMG/M |
3300010159|Ga0099796_10391060 | Not Available | 608 | Open in IMG/M |
3300010358|Ga0126370_10057251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2511 | Open in IMG/M |
3300010358|Ga0126370_10125533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1828 | Open in IMG/M |
3300010358|Ga0126370_10142459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1735 | Open in IMG/M |
3300010358|Ga0126370_10202615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1500 | Open in IMG/M |
3300010358|Ga0126370_11086603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 736 | Open in IMG/M |
3300010358|Ga0126370_11199156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300010358|Ga0126370_11256749 | Not Available | 691 | Open in IMG/M |
3300010358|Ga0126370_11740489 | Not Available | 601 | Open in IMG/M |
3300010358|Ga0126370_11767045 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 597 | Open in IMG/M |
3300010358|Ga0126370_12192017 | Not Available | 544 | Open in IMG/M |
3300010358|Ga0126370_12327989 | Not Available | 530 | Open in IMG/M |
3300010359|Ga0126376_10014782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4962 | Open in IMG/M |
3300010359|Ga0126376_11760242 | Not Available | 656 | Open in IMG/M |
3300010359|Ga0126376_12292902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 586 | Open in IMG/M |
3300010359|Ga0126376_12639590 | Not Available | 551 | Open in IMG/M |
3300010359|Ga0126376_13082316 | Not Available | 515 | Open in IMG/M |
3300010360|Ga0126372_10171476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1767 | Open in IMG/M |
3300010360|Ga0126372_10335773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
3300010360|Ga0126372_10398863 | Not Available | 1254 | Open in IMG/M |
3300010360|Ga0126372_10672328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
3300010360|Ga0126372_11040347 | Not Available | 833 | Open in IMG/M |
3300010360|Ga0126372_11156870 | Not Available | 796 | Open in IMG/M |
3300010360|Ga0126372_13180719 | Not Available | 510 | Open in IMG/M |
3300010361|Ga0126378_10232123 | Not Available | 1933 | Open in IMG/M |
3300010361|Ga0126378_10252353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1858 | Open in IMG/M |
3300010361|Ga0126378_10478996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
3300010361|Ga0126378_10610256 | Not Available | 1205 | Open in IMG/M |
3300010361|Ga0126378_10867103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1010 | Open in IMG/M |
3300010361|Ga0126378_11054384 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300010361|Ga0126378_11106849 | Not Available | 893 | Open in IMG/M |
3300010361|Ga0126378_11545255 | Not Available | 753 | Open in IMG/M |
3300010361|Ga0126378_11748307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 707 | Open in IMG/M |
3300010361|Ga0126378_12087244 | Not Available | 646 | Open in IMG/M |
3300010361|Ga0126378_12394683 | Not Available | 603 | Open in IMG/M |
3300010361|Ga0126378_12704321 | Not Available | 567 | Open in IMG/M |
3300010361|Ga0126378_12826556 | Not Available | 554 | Open in IMG/M |
3300010361|Ga0126378_12972189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300010362|Ga0126377_12344136 | Not Available | 610 | Open in IMG/M |
3300010362|Ga0126377_12456150 | Not Available | 597 | Open in IMG/M |
3300010362|Ga0126377_12604944 | Not Available | 581 | Open in IMG/M |
3300010362|Ga0126377_12953739 | Not Available | 549 | Open in IMG/M |
3300010362|Ga0126377_12980016 | Not Available | 546 | Open in IMG/M |
3300010366|Ga0126379_10129991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2306 | Open in IMG/M |
3300010366|Ga0126379_10231601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1803 | Open in IMG/M |
3300010366|Ga0126379_10496264 | Not Available | 1291 | Open in IMG/M |
3300010366|Ga0126379_10594671 | Not Available | 1191 | Open in IMG/M |
3300010366|Ga0126379_10606569 | Not Available | 1181 | Open in IMG/M |
3300010366|Ga0126379_10868191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 1004 | Open in IMG/M |
3300010366|Ga0126379_11052154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
3300010366|Ga0126379_11290626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
3300010366|Ga0126379_11575518 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 762 | Open in IMG/M |
3300010366|Ga0126379_11623603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 752 | Open in IMG/M |
3300010366|Ga0126379_11662621 | Not Available | 743 | Open in IMG/M |
3300010366|Ga0126379_12010267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300010366|Ga0126379_12093532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
3300010366|Ga0126379_12133066 | Not Available | 662 | Open in IMG/M |
3300010366|Ga0126379_12946738 | Not Available | 570 | Open in IMG/M |
3300010373|Ga0134128_12820627 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300010376|Ga0126381_100588058 | Not Available | 1582 | Open in IMG/M |
3300010376|Ga0126381_100882668 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300010376|Ga0126381_100959131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
3300010376|Ga0126381_100961099 | Not Available | 1231 | Open in IMG/M |
3300010376|Ga0126381_101019877 | Not Available | 1194 | Open in IMG/M |
3300010376|Ga0126381_101415340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
3300010376|Ga0126381_102075190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
3300010376|Ga0126381_103820479 | Not Available | 588 | Open in IMG/M |
3300010376|Ga0126381_104483675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
3300010376|Ga0126381_104661172 | Not Available | 528 | Open in IMG/M |
3300010376|Ga0126381_105011454 | Not Available | 508 | Open in IMG/M |
3300010398|Ga0126383_10251481 | Not Available | 1735 | Open in IMG/M |
3300010398|Ga0126383_10340943 | Not Available | 1515 | Open in IMG/M |
3300010398|Ga0126383_10529672 | Not Available | 1241 | Open in IMG/M |
3300010398|Ga0126383_10876509 | Not Available | 983 | Open in IMG/M |
3300010398|Ga0126383_10936800 | Not Available | 953 | Open in IMG/M |
3300010398|Ga0126383_11866717 | Not Available | 689 | Open in IMG/M |
3300010398|Ga0126383_12117559 | Not Available | 649 | Open in IMG/M |
3300010398|Ga0126383_12660424 | Not Available | 583 | Open in IMG/M |
3300010398|Ga0126383_12704325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300010398|Ga0126383_12885854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
3300010398|Ga0126383_12893367 | Not Available | 561 | Open in IMG/M |
3300010398|Ga0126383_13217488 | Not Available | 533 | Open in IMG/M |
3300010398|Ga0126383_13555977 | Not Available | 509 | Open in IMG/M |
3300010398|Ga0126383_13629660 | Not Available | 504 | Open in IMG/M |
3300010400|Ga0134122_10164937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1812 | Open in IMG/M |
3300010863|Ga0124850_1001411 | All Organisms → cellular organisms → Bacteria | 6600 | Open in IMG/M |
3300010863|Ga0124850_1007416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3471 | Open in IMG/M |
3300010863|Ga0124850_1109626 | Not Available | 748 | Open in IMG/M |
3300012022|Ga0120191_10001072 | Not Available | 2185 | Open in IMG/M |
3300012022|Ga0120191_10043495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
3300012199|Ga0137383_10953334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300012199|Ga0137383_10971643 | Not Available | 619 | Open in IMG/M |
3300012199|Ga0137383_11314380 | Not Available | 515 | Open in IMG/M |
3300012200|Ga0137382_10079499 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Mucoromycotina → Endogonomycetes → Endogonales → Endogonales incertae sedis → Bifiguratus → Bifiguratus adelaidae | 2123 | Open in IMG/M |
3300012200|Ga0137382_10943515 | Not Available | 621 | Open in IMG/M |
3300012200|Ga0137382_10951168 | Not Available | 618 | Open in IMG/M |
3300012201|Ga0137365_10096956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2220 | Open in IMG/M |
3300012201|Ga0137365_10146392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1775 | Open in IMG/M |
3300012202|Ga0137363_10192194 | Not Available | 1632 | Open in IMG/M |
3300012204|Ga0137374_10166743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1943 | Open in IMG/M |
3300012204|Ga0137374_10203315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1704 | Open in IMG/M |
3300012207|Ga0137381_10125347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2196 | Open in IMG/M |
3300012207|Ga0137381_11372099 | Not Available | 599 | Open in IMG/M |
3300012208|Ga0137376_11138025 | Not Available | 667 | Open in IMG/M |
3300012209|Ga0137379_10162983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2141 | Open in IMG/M |
3300012209|Ga0137379_10282817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1570 | Open in IMG/M |
3300012209|Ga0137379_10536343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1078 | Open in IMG/M |
3300012210|Ga0137378_10507724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
3300012211|Ga0137377_11350924 | Not Available | 642 | Open in IMG/M |
3300012211|Ga0137377_11587064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
3300012354|Ga0137366_10564165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
3300012358|Ga0137368_10200289 | Not Available | 1420 | Open in IMG/M |
3300012358|Ga0137368_10994163 | Not Available | 504 | Open in IMG/M |
3300012359|Ga0137385_11635142 | Not Available | 508 | Open in IMG/M |
3300012360|Ga0137375_10914827 | Not Available | 696 | Open in IMG/M |
3300012360|Ga0137375_10976220 | Not Available | 668 | Open in IMG/M |
3300012582|Ga0137358_10138536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1656 | Open in IMG/M |
3300012582|Ga0137358_10352789 | Not Available | 996 | Open in IMG/M |
3300012923|Ga0137359_10651796 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300012930|Ga0137407_10838943 | Not Available | 868 | Open in IMG/M |
3300012930|Ga0137407_12261478 | Not Available | 520 | Open in IMG/M |
3300012948|Ga0126375_10383302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
3300012948|Ga0126375_10435757 | Not Available | 958 | Open in IMG/M |
3300012948|Ga0126375_10441906 | Not Available | 953 | Open in IMG/M |
3300012948|Ga0126375_10750703 | Not Available | 766 | Open in IMG/M |
3300012948|Ga0126375_11049911 | Not Available | 667 | Open in IMG/M |
3300012948|Ga0126375_11123096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300012948|Ga0126375_11207727 | Not Available | 630 | Open in IMG/M |
3300012948|Ga0126375_11333276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300012948|Ga0126375_11878374 | Not Available | 525 | Open in IMG/M |
3300012948|Ga0126375_11900463 | Not Available | 523 | Open in IMG/M |
3300012948|Ga0126375_12056310 | Not Available | 506 | Open in IMG/M |
3300012951|Ga0164300_10871003 | Not Available | 566 | Open in IMG/M |
3300012955|Ga0164298_10098481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1543 | Open in IMG/M |
3300012961|Ga0164302_10992412 | Not Available | 653 | Open in IMG/M |
3300012971|Ga0126369_10904336 | Not Available | 968 | Open in IMG/M |
3300012971|Ga0126369_11101417 | Not Available | 883 | Open in IMG/M |
3300012971|Ga0126369_11623680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300012971|Ga0126369_11849997 | Not Available | 692 | Open in IMG/M |
3300012971|Ga0126369_12003841 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012971|Ga0126369_12327847 | Not Available | 622 | Open in IMG/M |
3300012971|Ga0126369_12501335 | Not Available | 602 | Open in IMG/M |
3300012971|Ga0126369_12625298 | Not Available | 588 | Open in IMG/M |
3300012971|Ga0126369_13060893 | Not Available | 547 | Open in IMG/M |
3300012971|Ga0126369_13240818 | Not Available | 533 | Open in IMG/M |
3300012971|Ga0126369_13507230 | Not Available | 514 | Open in IMG/M |
3300012989|Ga0164305_11387859 | Not Available | 618 | Open in IMG/M |
3300013297|Ga0157378_13238885 | Not Available | 506 | Open in IMG/M |
3300014968|Ga0157379_11811576 | Not Available | 600 | Open in IMG/M |
3300015371|Ga0132258_12782591 | Not Available | 1219 | Open in IMG/M |
3300015372|Ga0132256_103456278 | Not Available | 531 | Open in IMG/M |
3300015374|Ga0132255_100092209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4088 | Open in IMG/M |
3300016270|Ga0182036_10224131 | Not Available | 1392 | Open in IMG/M |
3300016270|Ga0182036_10476697 | Not Available | 985 | Open in IMG/M |
3300016270|Ga0182036_11066881 | Not Available | 668 | Open in IMG/M |
3300016270|Ga0182036_11324183 | Not Available | 601 | Open in IMG/M |
3300016270|Ga0182036_11704299 | Not Available | 532 | Open in IMG/M |
3300016270|Ga0182036_11906251 | Not Available | 504 | Open in IMG/M |
3300016294|Ga0182041_10420081 | Not Available | 1142 | Open in IMG/M |
3300016294|Ga0182041_10578130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
3300016294|Ga0182041_10790362 | Not Available | 847 | Open in IMG/M |
3300016294|Ga0182041_10859414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
3300016294|Ga0182041_11365358 | Not Available | 650 | Open in IMG/M |
3300016294|Ga0182041_12111401 | Not Available | 526 | Open in IMG/M |
3300016319|Ga0182033_10129102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1916 | Open in IMG/M |
3300016319|Ga0182033_10878175 | Not Available | 793 | Open in IMG/M |
3300016319|Ga0182033_10882761 | Not Available | 791 | Open in IMG/M |
3300016319|Ga0182033_11366251 | Not Available | 637 | Open in IMG/M |
3300016341|Ga0182035_11846821 | Not Available | 548 | Open in IMG/M |
3300016341|Ga0182035_12079860 | Not Available | 516 | Open in IMG/M |
3300016357|Ga0182032_10351721 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1179 | Open in IMG/M |
3300016357|Ga0182032_10544404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
3300016357|Ga0182032_10964831 | Not Available | 727 | Open in IMG/M |
3300016371|Ga0182034_11176641 | Not Available | 666 | Open in IMG/M |
3300016371|Ga0182034_11658060 | Not Available | 562 | Open in IMG/M |
3300016371|Ga0182034_11673518 | Not Available | 559 | Open in IMG/M |
3300016387|Ga0182040_10362073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
3300016387|Ga0182040_10678751 | Not Available | 840 | Open in IMG/M |
3300016387|Ga0182040_10849083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
3300016387|Ga0182040_11308613 | Not Available | 612 | Open in IMG/M |
3300016404|Ga0182037_10153021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1741 | Open in IMG/M |
3300016404|Ga0182037_10271434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1351 | Open in IMG/M |
3300016404|Ga0182037_10400873 | Not Available | 1130 | Open in IMG/M |
3300016404|Ga0182037_10858605 | Not Available | 785 | Open in IMG/M |
3300016404|Ga0182037_11081700 | Not Available | 701 | Open in IMG/M |
3300016404|Ga0182037_11108411 | Not Available | 693 | Open in IMG/M |
3300016404|Ga0182037_11638588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
3300016404|Ga0182037_11914509 | Not Available | 531 | Open in IMG/M |
3300016422|Ga0182039_10946716 | Not Available | 770 | Open in IMG/M |
3300016422|Ga0182039_11008810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 747 | Open in IMG/M |
3300016422|Ga0182039_12058331 | Not Available | 526 | Open in IMG/M |
3300016445|Ga0182038_10447567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1093 | Open in IMG/M |
3300016445|Ga0182038_10479075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
3300016445|Ga0182038_10957511 | Not Available | 756 | Open in IMG/M |
3300018433|Ga0066667_10046203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2592 | Open in IMG/M |
3300018468|Ga0066662_10394424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1213 | Open in IMG/M |
3300018468|Ga0066662_12312155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300020581|Ga0210399_10440928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1085 | Open in IMG/M |
3300021432|Ga0210384_11625011 | Not Available | 552 | Open in IMG/M |
3300021475|Ga0210392_10504623 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300021560|Ga0126371_10205580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2066 | Open in IMG/M |
3300021560|Ga0126371_10217589 | Not Available | 2013 | Open in IMG/M |
3300021560|Ga0126371_10217975 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300021560|Ga0126371_10335666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1644 | Open in IMG/M |
3300021560|Ga0126371_10514018 | Not Available | 1346 | Open in IMG/M |
3300021560|Ga0126371_10598652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1251 | Open in IMG/M |
3300021560|Ga0126371_10666211 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300021560|Ga0126371_10684232 | Not Available | 1174 | Open in IMG/M |
3300021560|Ga0126371_10779826 | Not Available | 1102 | Open in IMG/M |
3300021560|Ga0126371_10916974 | Not Available | 1020 | Open in IMG/M |
3300021560|Ga0126371_10932150 | Not Available | 1012 | Open in IMG/M |
3300021560|Ga0126371_10937943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
3300021560|Ga0126371_11219346 | Not Available | 888 | Open in IMG/M |
3300021560|Ga0126371_11253479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
3300021560|Ga0126371_11271600 | Not Available | 870 | Open in IMG/M |
3300021560|Ga0126371_11413425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300021560|Ga0126371_11472070 | Not Available | 810 | Open in IMG/M |
3300021560|Ga0126371_11494173 | Not Available | 804 | Open in IMG/M |
3300021560|Ga0126371_11503425 | Not Available | 802 | Open in IMG/M |
3300021560|Ga0126371_11664585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300021560|Ga0126371_11869650 | Not Available | 720 | Open in IMG/M |
3300021560|Ga0126371_12127104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300021560|Ga0126371_12188926 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300021560|Ga0126371_12412728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300021560|Ga0126371_12559170 | Not Available | 618 | Open in IMG/M |
3300021560|Ga0126371_12689098 | Not Available | 603 | Open in IMG/M |
3300021560|Ga0126371_13627488 | Not Available | 521 | Open in IMG/M |
3300021560|Ga0126371_13668859 | Not Available | 518 | Open in IMG/M |
3300021560|Ga0126371_13813330 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 508 | Open in IMG/M |
3300025910|Ga0207684_10028015 | All Organisms → cellular organisms → Bacteria | 4799 | Open in IMG/M |
3300025910|Ga0207684_10103960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2429 | Open in IMG/M |
3300025910|Ga0207684_10268161 | Not Available | 1473 | Open in IMG/M |
3300025915|Ga0207693_10491743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 958 | Open in IMG/M |
3300025922|Ga0207646_10263900 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300025922|Ga0207646_11299287 | Not Available | 635 | Open in IMG/M |
3300025928|Ga0207700_12018921 | Not Available | 504 | Open in IMG/M |
3300025939|Ga0207665_10967496 | Not Available | 676 | Open in IMG/M |
3300025939|Ga0207665_11507955 | Not Available | 534 | Open in IMG/M |
3300026306|Ga0209468_1119455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
3300026310|Ga0209239_1145848 | Not Available | 948 | Open in IMG/M |
3300026312|Ga0209153_1023767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2043 | Open in IMG/M |
3300026551|Ga0209648_10307075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
3300026555|Ga0179593_1117922 | Not Available | 2546 | Open in IMG/M |
3300026683|Ga0208210_100686 | Not Available | 578 | Open in IMG/M |
3300027071|Ga0209214_1002247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1874 | Open in IMG/M |
3300027326|Ga0209731_1009013 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300027502|Ga0209622_1023517 | Not Available | 1084 | Open in IMG/M |
3300027576|Ga0209003_1001709 | Not Available | 2538 | Open in IMG/M |
3300027646|Ga0209466_1005009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2778 | Open in IMG/M |
3300027654|Ga0209799_1063276 | Not Available | 831 | Open in IMG/M |
3300027874|Ga0209465_10127779 | Not Available | 1255 | Open in IMG/M |
3300027874|Ga0209465_10220873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 946 | Open in IMG/M |
3300027874|Ga0209465_10402224 | Not Available | 685 | Open in IMG/M |
3300027874|Ga0209465_10683379 | Not Available | 504 | Open in IMG/M |
3300027903|Ga0209488_10092241 | Not Available | 2264 | Open in IMG/M |
3300027903|Ga0209488_10214624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1448 | Open in IMG/M |
3300028878|Ga0307278_10147406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1055 | Open in IMG/M |
3300028885|Ga0307304_10304036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300031446|Ga0170820_17243455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300031543|Ga0318516_10004778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6069 | Open in IMG/M |
3300031543|Ga0318516_10009952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4559 | Open in IMG/M |
3300031543|Ga0318516_10016508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3689 | Open in IMG/M |
3300031543|Ga0318516_10026837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3006 | Open in IMG/M |
3300031543|Ga0318516_10028279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2935 | Open in IMG/M |
3300031543|Ga0318516_10037730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2581 | Open in IMG/M |
3300031543|Ga0318516_10084934 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300031543|Ga0318516_10092569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
3300031543|Ga0318516_10127417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1454 | Open in IMG/M |
3300031543|Ga0318516_10168521 | Not Available | 1260 | Open in IMG/M |
3300031543|Ga0318516_10181275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
3300031543|Ga0318516_10240266 | Not Available | 1048 | Open in IMG/M |
3300031543|Ga0318516_10269788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
3300031543|Ga0318516_10274015 | Not Available | 975 | Open in IMG/M |
3300031543|Ga0318516_10304303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
3300031543|Ga0318516_10496488 | Not Available | 700 | Open in IMG/M |
3300031543|Ga0318516_10508991 | Not Available | 691 | Open in IMG/M |
3300031543|Ga0318516_10543126 | Not Available | 665 | Open in IMG/M |
3300031543|Ga0318516_10585004 | Not Available | 638 | Open in IMG/M |
3300031544|Ga0318534_10195078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
3300031545|Ga0318541_10030191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2680 | Open in IMG/M |
3300031545|Ga0318541_10033085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2574 | Open in IMG/M |
3300031545|Ga0318541_10034277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2536 | Open in IMG/M |
3300031545|Ga0318541_10054728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2058 | Open in IMG/M |
3300031545|Ga0318541_10056773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2024 | Open in IMG/M |
3300031545|Ga0318541_10079670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1731 | Open in IMG/M |
3300031545|Ga0318541_10080461 | Not Available | 1723 | Open in IMG/M |
3300031545|Ga0318541_10092464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
3300031545|Ga0318541_10092478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1614 | Open in IMG/M |
3300031545|Ga0318541_10151301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
3300031545|Ga0318541_10251761 | Not Available | 981 | Open in IMG/M |
3300031545|Ga0318541_10260929 | Not Available | 963 | Open in IMG/M |
3300031545|Ga0318541_10522065 | Not Available | 664 | Open in IMG/M |
3300031545|Ga0318541_10533720 | Not Available | 656 | Open in IMG/M |
3300031545|Ga0318541_10609846 | Not Available | 610 | Open in IMG/M |
3300031545|Ga0318541_10625139 | Not Available | 602 | Open in IMG/M |
3300031545|Ga0318541_10653769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300031545|Ga0318541_10685076 | Not Available | 572 | Open in IMG/M |
3300031545|Ga0318541_10715885 | Not Available | 559 | Open in IMG/M |
3300031546|Ga0318538_10005593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4800 | Open in IMG/M |
3300031546|Ga0318538_10011402 | All Organisms → cellular organisms → Bacteria | 3711 | Open in IMG/M |
3300031546|Ga0318538_10044832 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300031546|Ga0318538_10107686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
3300031546|Ga0318538_10124460 | Not Available | 1348 | Open in IMG/M |
3300031546|Ga0318538_10126212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
3300031546|Ga0318538_10661752 | Not Available | 567 | Open in IMG/M |
3300031549|Ga0318571_10033106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1451 | Open in IMG/M |
3300031561|Ga0318528_10344158 | Not Available | 800 | Open in IMG/M |
3300031561|Ga0318528_10787516 | Not Available | 508 | Open in IMG/M |
3300031564|Ga0318573_10043230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2168 | Open in IMG/M |
3300031564|Ga0318573_10258764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
3300031564|Ga0318573_10409679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
3300031564|Ga0318573_10458829 | Not Available | 685 | Open in IMG/M |
3300031564|Ga0318573_10724169 | Not Available | 535 | Open in IMG/M |
3300031572|Ga0318515_10067929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1826 | Open in IMG/M |
3300031573|Ga0310915_10047530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2758 | Open in IMG/M |
3300031573|Ga0310915_10081439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 2153 | Open in IMG/M |
3300031573|Ga0310915_10185130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1452 | Open in IMG/M |
3300031573|Ga0310915_10252394 | Not Available | 1241 | Open in IMG/M |
3300031573|Ga0310915_10281921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1172 | Open in IMG/M |
3300031573|Ga0310915_10302953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1129 | Open in IMG/M |
3300031573|Ga0310915_10368252 | Not Available | 1019 | Open in IMG/M |
3300031573|Ga0310915_10430039 | Not Available | 938 | Open in IMG/M |
3300031573|Ga0310915_10434001 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300031573|Ga0310915_10453833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300031573|Ga0310915_10470152 | Not Available | 893 | Open in IMG/M |
3300031573|Ga0310915_10556929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 813 | Open in IMG/M |
3300031573|Ga0310915_10590285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
3300031573|Ga0310915_10897004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300031640|Ga0318555_10198520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1081 | Open in IMG/M |
3300031640|Ga0318555_10475314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300031640|Ga0318555_10583741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300031668|Ga0318542_10268213 | Not Available | 870 | Open in IMG/M |
3300031668|Ga0318542_10307148 | Not Available | 812 | Open in IMG/M |
3300031668|Ga0318542_10357974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300031668|Ga0318542_10439336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300031680|Ga0318574_10295443 | Not Available | 941 | Open in IMG/M |
3300031680|Ga0318574_10506521 | Not Available | 707 | Open in IMG/M |
3300031680|Ga0318574_10932870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300031681|Ga0318572_10200434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1165 | Open in IMG/M |
3300031681|Ga0318572_10613107 | Not Available | 648 | Open in IMG/M |
3300031682|Ga0318560_10391220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
3300031682|Ga0318560_10489714 | Not Available | 666 | Open in IMG/M |
3300031682|Ga0318560_10574802 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300031713|Ga0318496_10407611 | Not Available | 751 | Open in IMG/M |
3300031713|Ga0318496_10420853 | Not Available | 738 | Open in IMG/M |
3300031713|Ga0318496_10468261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
3300031719|Ga0306917_10011536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5111 | Open in IMG/M |
3300031719|Ga0306917_10273080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1300 | Open in IMG/M |
3300031719|Ga0306917_10360131 | Not Available | 1132 | Open in IMG/M |
3300031719|Ga0306917_10720400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
3300031719|Ga0306917_10758539 | Not Available | 761 | Open in IMG/M |
3300031719|Ga0306917_11368642 | Not Available | 546 | Open in IMG/M |
3300031719|Ga0306917_11583421 | Not Available | 503 | Open in IMG/M |
3300031723|Ga0318493_10836646 | Not Available | 519 | Open in IMG/M |
3300031724|Ga0318500_10042220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1897 | Open in IMG/M |
3300031724|Ga0318500_10436195 | Not Available | 654 | Open in IMG/M |
3300031736|Ga0318501_10017984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2912 | Open in IMG/M |
3300031736|Ga0318501_10156341 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300031736|Ga0318501_10166325 | Not Available | 1142 | Open in IMG/M |
3300031736|Ga0318501_10384014 | Not Available | 757 | Open in IMG/M |
3300031744|Ga0306918_10044119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2919 | Open in IMG/M |
3300031744|Ga0306918_10074084 | Not Available | 2349 | Open in IMG/M |
3300031744|Ga0306918_10096635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2093 | Open in IMG/M |
3300031744|Ga0306918_10398443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1072 | Open in IMG/M |
3300031744|Ga0306918_10823122 | Not Available | 724 | Open in IMG/M |
3300031744|Ga0306918_10835033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300031744|Ga0306918_10849471 | Not Available | 712 | Open in IMG/M |
3300031744|Ga0306918_10935881 | Not Available | 674 | Open in IMG/M |
3300031744|Ga0306918_11328355 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031747|Ga0318502_10007164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4858 | Open in IMG/M |
3300031747|Ga0318502_10768282 | Not Available | 583 | Open in IMG/M |
3300031748|Ga0318492_10636362 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 570 | Open in IMG/M |
3300031751|Ga0318494_10031114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2729 | Open in IMG/M |
3300031751|Ga0318494_10201061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
3300031751|Ga0318494_10213935 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300031751|Ga0318494_10634735 | Not Available | 625 | Open in IMG/M |
3300031763|Ga0318537_10002816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5489 | Open in IMG/M |
3300031764|Ga0318535_10015918 | Not Available | 2804 | Open in IMG/M |
3300031764|Ga0318535_10251522 | Not Available | 791 | Open in IMG/M |
3300031764|Ga0318535_10311179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
3300031764|Ga0318535_10437840 | Not Available | 582 | Open in IMG/M |
3300031765|Ga0318554_10182809 | Not Available | 1193 | Open in IMG/M |
3300031769|Ga0318526_10402534 | Not Available | 559 | Open in IMG/M |
3300031771|Ga0318546_10520181 | Not Available | 835 | Open in IMG/M |
3300031771|Ga0318546_11055728 | Not Available | 571 | Open in IMG/M |
3300031779|Ga0318566_10216959 | Not Available | 950 | Open in IMG/M |
3300031780|Ga0318508_1156036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300031781|Ga0318547_10223872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
3300031792|Ga0318529_10006358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4177 | Open in IMG/M |
3300031792|Ga0318529_10071308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1533 | Open in IMG/M |
3300031792|Ga0318529_10448309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300031793|Ga0318548_10114693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
3300031793|Ga0318548_10408802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. G22 | 665 | Open in IMG/M |
3300031794|Ga0318503_10003075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3786 | Open in IMG/M |
3300031794|Ga0318503_10009661 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
3300031794|Ga0318503_10271709 | Not Available | 550 | Open in IMG/M |
3300031798|Ga0318523_10054108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1893 | Open in IMG/M |
3300031798|Ga0318523_10212541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
3300031798|Ga0318523_10336085 | Not Available | 752 | Open in IMG/M |
3300031805|Ga0318497_10074425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1790 | Open in IMG/M |
3300031805|Ga0318497_10258084 | Not Available | 967 | Open in IMG/M |
3300031805|Ga0318497_10485336 | Not Available | 692 | Open in IMG/M |
3300031805|Ga0318497_10832344 | Not Available | 518 | Open in IMG/M |
3300031819|Ga0318568_10400240 | Not Available | 855 | Open in IMG/M |
3300031832|Ga0318499_10268981 | Not Available | 660 | Open in IMG/M |
3300031833|Ga0310917_10108216 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
3300031833|Ga0310917_10134700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1619 | Open in IMG/M |
3300031833|Ga0310917_10190604 | Not Available | 1368 | Open in IMG/M |
3300031833|Ga0310917_10714275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300031833|Ga0310917_10905276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300031835|Ga0318517_10093389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
3300031835|Ga0318517_10202853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
3300031845|Ga0318511_10115549 | Not Available | 1152 | Open in IMG/M |
3300031845|Ga0318511_10160465 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300031845|Ga0318511_10258372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
3300031859|Ga0318527_10043445 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
3300031860|Ga0318495_10364145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
3300031879|Ga0306919_10027451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3542 | Open in IMG/M |
3300031879|Ga0306919_10110660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1949 | Open in IMG/M |
3300031879|Ga0306919_10240554 | Not Available | 1359 | Open in IMG/M |
3300031879|Ga0306919_10279135 | Not Available | 1263 | Open in IMG/M |
3300031879|Ga0306919_10368163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1099 | Open in IMG/M |
3300031879|Ga0306919_10544547 | Not Available | 895 | Open in IMG/M |
3300031879|Ga0306919_10895478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300031879|Ga0306919_11273528 | Not Available | 557 | Open in IMG/M |
3300031879|Ga0306919_11412083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 525 | Open in IMG/M |
3300031879|Ga0306919_11490503 | Not Available | 509 | Open in IMG/M |
3300031880|Ga0318544_10013329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2648 | Open in IMG/M |
3300031880|Ga0318544_10101596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
3300031880|Ga0318544_10292086 | Not Available | 632 | Open in IMG/M |
3300031890|Ga0306925_10009515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9264 | Open in IMG/M |
3300031890|Ga0306925_10428471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1415 | Open in IMG/M |
3300031890|Ga0306925_10494424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1303 | Open in IMG/M |
3300031890|Ga0306925_10502969 | Not Available | 1290 | Open in IMG/M |
3300031890|Ga0306925_10700094 | Not Available | 1060 | Open in IMG/M |
3300031890|Ga0306925_10701383 | Not Available | 1059 | Open in IMG/M |
3300031890|Ga0306925_11021400 | Not Available | 841 | Open in IMG/M |
3300031890|Ga0306925_11104803 | Not Available | 801 | Open in IMG/M |
3300031890|Ga0306925_11298746 | Not Available | 723 | Open in IMG/M |
3300031890|Ga0306925_11585559 | Not Available | 637 | Open in IMG/M |
3300031893|Ga0318536_10016073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3313 | Open in IMG/M |
3300031893|Ga0318536_10043200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2154 | Open in IMG/M |
3300031894|Ga0318522_10406565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300031896|Ga0318551_10391454 | Not Available | 790 | Open in IMG/M |
3300031896|Ga0318551_10521204 | Not Available | 682 | Open in IMG/M |
3300031897|Ga0318520_10130814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
3300031897|Ga0318520_10168341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1279 | Open in IMG/M |
3300031897|Ga0318520_10573404 | Not Available | 700 | Open in IMG/M |
3300031897|Ga0318520_10803590 | Not Available | 590 | Open in IMG/M |
3300031910|Ga0306923_10135365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2805 | Open in IMG/M |
3300031910|Ga0306923_10143976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2717 | Open in IMG/M |
3300031910|Ga0306923_10153912 | Not Available | 2625 | Open in IMG/M |
3300031910|Ga0306923_10757297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1076 | Open in IMG/M |
3300031910|Ga0306923_11164416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
3300031910|Ga0306923_11978635 | Not Available | 592 | Open in IMG/M |
3300031910|Ga0306923_12047313 | Not Available | 579 | Open in IMG/M |
3300031910|Ga0306923_12174327 | Not Available | 557 | Open in IMG/M |
3300031910|Ga0306923_12374496 | Not Available | 526 | Open in IMG/M |
3300031912|Ga0306921_10077069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3834 | Open in IMG/M |
3300031912|Ga0306921_10378870 | Not Available | 1653 | Open in IMG/M |
3300031912|Ga0306921_10450953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1498 | Open in IMG/M |
3300031912|Ga0306921_12062877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas yamanorum | 605 | Open in IMG/M |
3300031912|Ga0306921_12096000 | Not Available | 599 | Open in IMG/M |
3300031912|Ga0306921_12140693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
3300031912|Ga0306921_12354354 | Not Available | 557 | Open in IMG/M |
3300031912|Ga0306921_12733737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
3300031941|Ga0310912_10134950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1850 | Open in IMG/M |
3300031941|Ga0310912_10460351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
3300031942|Ga0310916_10113246 | Not Available | 2196 | Open in IMG/M |
3300031942|Ga0310916_10126719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2083 | Open in IMG/M |
3300031942|Ga0310916_11026105 | Not Available | 687 | Open in IMG/M |
3300031942|Ga0310916_11082859 | Not Available | 666 | Open in IMG/M |
3300031942|Ga0310916_11107909 | Not Available | 657 | Open in IMG/M |
3300031945|Ga0310913_10334901 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300031945|Ga0310913_10859633 | Not Available | 639 | Open in IMG/M |
3300031946|Ga0310910_10110415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2055 | Open in IMG/M |
3300031946|Ga0310910_10660652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 827 | Open in IMG/M |
3300031946|Ga0310910_10722043 | Not Available | 787 | Open in IMG/M |
3300031947|Ga0310909_10098540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2345 | Open in IMG/M |
3300031947|Ga0310909_10582746 | Not Available | 935 | Open in IMG/M |
3300031947|Ga0310909_10728657 | Not Available | 822 | Open in IMG/M |
3300031947|Ga0310909_11408821 | Not Available | 557 | Open in IMG/M |
3300031954|Ga0306926_10063746 | Not Available | 4441 | Open in IMG/M |
3300031954|Ga0306926_10122426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3208 | Open in IMG/M |
3300031954|Ga0306926_10125224 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
3300031954|Ga0306926_10254775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2174 | Open in IMG/M |
3300031954|Ga0306926_10283249 | Not Available | 2052 | Open in IMG/M |
3300031954|Ga0306926_10954191 | Not Available | 1023 | Open in IMG/M |
3300031954|Ga0306926_11984052 | Not Available | 655 | Open in IMG/M |
3300031959|Ga0318530_10033824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1848 | Open in IMG/M |
3300031959|Ga0318530_10095918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1174 | Open in IMG/M |
3300031959|Ga0318530_10248198 | Not Available | 733 | Open in IMG/M |
3300031959|Ga0318530_10287866 | Not Available | 678 | Open in IMG/M |
3300031959|Ga0318530_10412560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300031981|Ga0318531_10073946 | Not Available | 1477 | Open in IMG/M |
3300032001|Ga0306922_10314762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
3300032001|Ga0306922_10827554 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300032001|Ga0306922_10865902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
3300032001|Ga0306922_10931929 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300032001|Ga0306922_11049316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
3300032001|Ga0306922_12384597 | Not Available | 505 | Open in IMG/M |
3300032010|Ga0318569_10315583 | Not Available | 728 | Open in IMG/M |
3300032025|Ga0318507_10027955 | Not Available | 2077 | Open in IMG/M |
3300032025|Ga0318507_10170515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
3300032035|Ga0310911_10255729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
3300032039|Ga0318559_10596830 | Not Available | 515 | Open in IMG/M |
3300032041|Ga0318549_10041080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1874 | Open in IMG/M |
3300032041|Ga0318549_10194086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
3300032042|Ga0318545_10123409 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300032042|Ga0318545_10265673 | Not Available | 616 | Open in IMG/M |
3300032043|Ga0318556_10253442 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300032043|Ga0318556_10379547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 739 | Open in IMG/M |
3300032044|Ga0318558_10240945 | Not Available | 888 | Open in IMG/M |
3300032059|Ga0318533_10070140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2371 | Open in IMG/M |
3300032059|Ga0318533_10169942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1550 | Open in IMG/M |
3300032059|Ga0318533_10622127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300032059|Ga0318533_10882289 | Not Available | 656 | Open in IMG/M |
3300032059|Ga0318533_11259318 | Not Available | 541 | Open in IMG/M |
3300032059|Ga0318533_11401167 | Not Available | 510 | Open in IMG/M |
3300032059|Ga0318533_11401767 | Not Available | 510 | Open in IMG/M |
3300032059|Ga0318533_11439726 | Not Available | 503 | Open in IMG/M |
3300032060|Ga0318505_10276601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
3300032060|Ga0318505_10560566 | Not Available | 537 | Open in IMG/M |
3300032064|Ga0318510_10010990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2648 | Open in IMG/M |
3300032064|Ga0318510_10447881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
3300032064|Ga0318510_10518227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300032067|Ga0318524_10135837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1237 | Open in IMG/M |
3300032068|Ga0318553_10062764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1847 | Open in IMG/M |
3300032068|Ga0318553_10289403 | Not Available | 857 | Open in IMG/M |
3300032076|Ga0306924_10112941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3083 | Open in IMG/M |
3300032076|Ga0306924_10256391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2008 | Open in IMG/M |
3300032090|Ga0318518_10727298 | Not Available | 504 | Open in IMG/M |
3300032091|Ga0318577_10277954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
3300032091|Ga0318577_10405565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300032174|Ga0307470_11772102 | Not Available | 522 | Open in IMG/M |
3300032205|Ga0307472_101508488 | Not Available | 657 | Open in IMG/M |
3300032261|Ga0306920_100011482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11967 | Open in IMG/M |
3300032261|Ga0306920_100381793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2095 | Open in IMG/M |
3300032261|Ga0306920_100444102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1927 | Open in IMG/M |
3300032261|Ga0306920_100596501 | Not Available | 1634 | Open in IMG/M |
3300032261|Ga0306920_100668673 | Not Available | 1532 | Open in IMG/M |
3300032261|Ga0306920_100948513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1255 | Open in IMG/M |
3300032261|Ga0306920_101469456 | Not Available | 974 | Open in IMG/M |
3300032261|Ga0306920_101677387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
3300032261|Ga0306920_101902684 | Not Available | 836 | Open in IMG/M |
3300032261|Ga0306920_102942876 | Not Available | 644 | Open in IMG/M |
3300032261|Ga0306920_103250392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300032261|Ga0306920_104465129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300033289|Ga0310914_10487838 | Not Available | 1115 | Open in IMG/M |
3300033289|Ga0310914_10738043 | Not Available | 881 | Open in IMG/M |
3300033289|Ga0310914_10791070 | Not Available | 846 | Open in IMG/M |
3300033289|Ga0310914_11092574 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300033290|Ga0318519_10130349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
3300033290|Ga0318519_10604097 | Not Available | 666 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 21.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.82% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.22% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.22% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.22% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.22% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.22% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.11% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.11% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.11% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.11% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026683 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02512570 | 2088090014 | Soil | MREHVLLFFLVGLLLTAAIMLMVAPASVTWALSFIQ |
KansclcFeb2_06656030 | 2124908045 | Soil | MRDHVLLFCLMALLLTAAIILIIAPGHVTWALSLIE |
E4B_03430850 | 2170459004 | Grass Soil | MREHVLLFCLLGLVLTATIVLVAAPGAVTWALALIE |
E41_05941890 | 2170459005 | Grass Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALAHIE |
FD1_09041350 | 2170459024 | Grass Soil | MREQVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
ICChiseqgaiiFebDRAFT_109104152 | 3300000363 | Soil | MREHVLLFFLVGLLLTAAIMLMVAPASVTWALSFIQ* |
AP72_2010_repI_A01DRAFT_10090383 | 3300000579 | Forest Soil | MREQVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
AP72_2010_repI_A01DRAFT_10553851 | 3300000579 | Forest Soil | MRERVLLFCLLGLVLTATIILVIAPEAVTWALALFE* |
AP72_2010_repI_A01DRAFT_10691622 | 3300000579 | Forest Soil | MRERMLLFCLLGLMLTATIILVVAPGAVTWALALIE* |
AF_2010_repII_A01DRAFT_10052631 | 3300000580 | Forest Soil | MRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE* |
AF_2010_repII_A01DRAFT_10171213 | 3300000580 | Forest Soil | MAMKPARFERVLLFCLLGLVLAITIMLVIEPRAVTWAVGLIE* |
AF_2010_repII_A01DRAFT_10174061 | 3300000580 | Forest Soil | MREHVLLFCLLGLVLAATIMLVAAPGAVTGALALIE* |
AF_2010_repII_A01DRAFT_10551353 | 3300000580 | Forest Soil | EHVLLFCLLGLVLTATIILAIAPGAVTWALSLID* |
AF_2010_repII_A1DRAFT_100075547 | 3300000597 | Forest Soil | MRDNVFLFCLVGLVLTAAIMLLIAPGEVTWVLALIEGPY* |
AF_2010_repII_A1DRAFT_100156001 | 3300000597 | Forest Soil | MATKPARFERVLLFCLLGLVLTATILLVTEPGAVTWALSFIE* |
AF_2010_repII_A1DRAFT_100171002 | 3300000597 | Forest Soil | MRDNVLLFSLVGLVLIAAIMLLIAPGEVTWALSLIEGPY* |
AF_2010_repII_A1DRAFT_100192413 | 3300000597 | Forest Soil | MREHVLIFCLLGLVLIAAIMLLIAPGEVTWALSLIE* |
AF_2010_repII_A1DRAFT_100271665 | 3300000597 | Forest Soil | MAXKPXRFERVLLFCLLGLVLAITIMLVIEPGAVTWAVG |
AF_2010_repII_A1DRAFT_100321951 | 3300000597 | Forest Soil | DGMDERALLFCLLGLVVTAAIILAVAPGAVTWTMSLVE* |
AF_2010_repII_A1DRAFT_100388881 | 3300000597 | Forest Soil | DGMDERALLFCLLSLVLTAAIILAVAPGAVTWAMSFVE* |
AF_2010_repII_A1DRAFT_100709751 | 3300000597 | Forest Soil | MREHVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE* |
AF_2010_repII_A1DRAFT_100864972 | 3300000597 | Forest Soil | MREHVLLFCLVGLVLIAAIVLLVAPGEVTWALALIEGPP* |
AF_2010_repII_A1DRAFT_100900102 | 3300000597 | Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALVE* |
AF_2010_repII_A1DRAFT_100923473 | 3300000597 | Forest Soil | MRDHVLLFFLLGLLLMAVVILITAPGPVTWALSLVE* |
AF_2010_repII_A1DRAFT_101040782 | 3300000597 | Forest Soil | MRDHVLLFSLLGLVLTATIILATAPEAVTWALALIE* |
AF_2010_repII_A1DRAFT_101157453 | 3300000597 | Forest Soil | DMREHVLLFCLLGLVLAITIMLVIEPGAVTWAVGLVE* |
AF_2010_repII_A1DRAFT_101574321 | 3300000597 | Forest Soil | MREHVLLFCLLGLVLTATITLAIAPGAVTWALALID* |
AF_2010_repII_A1DRAFT_101642981 | 3300000597 | Forest Soil | LRATDMREHVLLFCLLGLVLTATIILMTAPGAVTWALALIE* |
AF_2010_repII_A1DRAFT_101757862 | 3300000597 | Forest Soil | LLFCLLGLVLIVAIMLLIAPEEVTWALSLIDEMT* |
AP72_2010_repI_A10DRAFT_10386683 | 3300000651 | Forest Soil | MDERALLFCLLGLVLTAAIILAVAPEAVTWTMSLVE* |
AP72_2010_repI_A10DRAFT_10390353 | 3300000651 | Forest Soil | MREHVLLFCLLGLVLTATILLMTAPGAVTWALAFLEAW |
AF_2010_repII_A100DRAFT_10299764 | 3300000655 | Forest Soil | MATKPARFEHVLLFCLLGLVLTATILLVTAPGAVTRALSLI |
AF_2010_repII_A100DRAFT_10352853 | 3300000655 | Forest Soil | MATKPARFEHVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
AF_2010_repII_A100DRAFT_10768212 | 3300000655 | Forest Soil | MREXVLLFCLLGLVLAITIMLVIEPGAVTWAVGLIE* |
AF_2010_repII_A100DRAFT_10959431 | 3300000655 | Forest Soil | MREHVLLFCLLGLVLTATILLMTAPGAVTWALAFLEAWISGLLGW |
AF_2010_repII_A001DRAFT_100576401 | 3300000793 | Forest Soil | FVLRGAMREHVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE* |
AF_2010_repII_A001DRAFT_100728282 | 3300000793 | Forest Soil | LCTKGTDMREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID* |
AF_2010_repII_A001DRAFT_100746203 | 3300000793 | Forest Soil | MREHVLLFCLLGLVLIATITLVTAPGAVTWALSLIE* |
AF_2010_repII_A001DRAFT_100898472 | 3300000793 | Forest Soil | VLLFCLLGLVLIAAIMLLIAPAEVTWALSLIDSVMS* |
AF_2010_repII_A001DRAFT_101018692 | 3300000793 | Forest Soil | MREHVLLFCLLGLVLAITIMLVIEPRAVTWAVGLIE* |
AF_2010_repII_A001DRAFT_101350981 | 3300000793 | Forest Soil | MRERVLLFCLLGLVLTATIILVTAPGVVTWAVALIE* |
AP72_2010_repI_A100DRAFT_10346912 | 3300000837 | Forest Soil | MRDHVLLFCLVGLVLIAAIMLLLAPGEVTWALSLIEGPP* |
AP72_2010_repI_A100DRAFT_10479302 | 3300000837 | Forest Soil | MREHILLFSVLGLLLMAAIILMVAPGPVTWALSIID* |
AP72_2010_repI_A001DRAFT_10204532 | 3300000893 | Forest Soil | MREHVLLFCLLGLVLAITIMLVIEPGAVTWAVGLIE* |
JGI1027J12803_1049481312 | 3300000955 | Soil | MGEHVLLFCLLGLVLTATIILVVAPGAVTLALSLVE* |
JGI10216J12902_1031827522 | 3300000956 | Soil | MREHVLLFCLLGVVLAATIILATAPEAVTWALAFIE* |
JGI12627J18819_100821553 | 3300001867 | Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALGLIE* |
JGI12627J18819_100977163 | 3300001867 | Forest Soil | MREYVLLVCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0066395_100688831 | 3300004633 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0066395_102669772 | 3300004633 | Tropical Forest Soil | LCTKGTDMRERVLLFCLLGLVLAATITLVTAPGAVTWALALIE* |
Ga0066395_102914031 | 3300004633 | Tropical Forest Soil | LTDMLREHVLLVCLLGLVFTATIILMAAPGAVTWALALIE* |
Ga0066395_103193013 | 3300004633 | Tropical Forest Soil | FCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0066395_103691202 | 3300004633 | Tropical Forest Soil | LCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0066395_108127371 | 3300004633 | Tropical Forest Soil | LCSCTKGTDMREQVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0066678_111120792 | 3300005181 | Soil | LTDMRERVLLFCLLGLVLAATIMLVTAPKAVTWALALIE* |
Ga0066671_100383382 | 3300005184 | Soil | MAVGMGERVLFFCLVGLLLTAAIILMIAPGSVTWALSFIQ* |
Ga0066388_1002311393 | 3300005332 | Tropical Forest Soil | LCTEGTLMREHVLLFCLLGVVLTATIMLLTAPEAVTWALALIE* |
Ga0066388_1004661813 | 3300005332 | Tropical Forest Soil | MATKPARFERVLLFCLLGLVLTATILLVTAPGAVIWALSLIE* |
Ga0066388_1005163914 | 3300005332 | Tropical Forest Soil | MREHVLLFCLLGLVLTVTIILVIAPGAVTWALQRYLGSK* |
Ga0066388_1007174244 | 3300005332 | Tropical Forest Soil | FCTKDTDMREHVLLLCLLGLVLAATVMLVTAPGAVTWALALIE* |
Ga0066388_1007287923 | 3300005332 | Tropical Forest Soil | FCTKGTDVREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066388_1007813523 | 3300005332 | Tropical Forest Soil | LTDMRERVLLFCLLGLVLAATIVLVTAPKAVTWALALIE* |
Ga0066388_1012579651 | 3300005332 | Tropical Forest Soil | CFCTKGADMRERVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0066388_1016001224 | 3300005332 | Tropical Forest Soil | FCTKGTDVREHVLLFCLLGLVLTATIILVIAPGAVTWALAFIE* |
Ga0066388_1016132252 | 3300005332 | Tropical Forest Soil | LTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066388_1017498991 | 3300005332 | Tropical Forest Soil | MGAFAGVCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0066388_1024278032 | 3300005332 | Tropical Forest Soil | MREHMLLFCLLGLVLTAAIILVIAPGAVTWALAFIEGSVPQSR* |
Ga0066388_1029071411 | 3300005332 | Tropical Forest Soil | LCSCTKGTDMHERVLLFCLLGLVLTATIILVIAPGAVTWALALVE* |
Ga0066388_1029360752 | 3300005332 | Tropical Forest Soil | CTKGTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066388_1035274032 | 3300005332 | Tropical Forest Soil | FCTKGTDMREHVLLFCLLGLVLTATTILVIAPGAVTWALALIE* |
Ga0066388_1035289023 | 3300005332 | Tropical Forest Soil | LRFCTRGTDMREHVLLFCLLGLVLTATIILVTAPEAVTWALALME* |
Ga0066388_1036802092 | 3300005332 | Tropical Forest Soil | MRNLMLLFCLLGLVGLVAIMLLIAPEEVTWALSLIDEMT* |
Ga0066388_1042822641 | 3300005332 | Tropical Forest Soil | LAFVLRGTDMREHMLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066388_1043807092 | 3300005332 | Tropical Forest Soil | LCSCSKGTDMREHVLLFCLLGLVLAIAIMLVIEPGAVTWAVGLIE* |
Ga0066388_1045319322 | 3300005332 | Tropical Forest Soil | AAMAVGMGERVLFFCLVGLLLTAAIILMVAPGSVTWALSFIQ* |
Ga0066388_1051550952 | 3300005332 | Tropical Forest Soil | FCFCTKGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWAMSLID* |
Ga0066388_1060945341 | 3300005332 | Tropical Forest Soil | MREHVLLFCPLGLVLTATIILMAAPGAVTWALALIE*AAPA |
Ga0066388_1063666471 | 3300005332 | Tropical Forest Soil | CFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0066388_1081455431 | 3300005332 | Tropical Forest Soil | MRNRVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0066388_1081753901 | 3300005332 | Tropical Forest Soil | LCSCTKGTDMRERVLLFCLLGLVLTAAMMLAVAPGAVTWALALIE* |
Ga0066388_1082327142 | 3300005332 | Tropical Forest Soil | GTDMRERVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0008090_100371071 | 3300005363 | Tropical Rainforest Soil | MREHVLLFCLLGLVLIAAIMLLIAPAEVTWALSLIDSVMS* |
Ga0008090_100444582 | 3300005363 | Tropical Rainforest Soil | MREHVLLFCLLGLVGLVAIMLLIAPEEVTWALSLIDEMT* |
Ga0008090_100615883 | 3300005363 | Tropical Rainforest Soil | FCTKGTDMREHVLLFCLLGLVLTATITLAIAPGAVTWALALID* |
Ga0008090_102585952 | 3300005363 | Tropical Rainforest Soil | MREHVLIFCLLGLVLIAAIMLLIAPGEVTWALSLIEGPY* |
Ga0008090_158653553 | 3300005363 | Tropical Rainforest Soil | GTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0070713_1010144581 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EATDMGEHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066689_106432201 | 3300005447 | Soil | GTDMREHVLLFCLLGLVLTAAIILVIAPGTVTWALSLMID* |
Ga0070706_1002843692 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0070697_1006047733 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VREHILLFGVLGLLLMAAIILMVAPGPVTWALSLIDENFK |
Ga0070704_1005492792 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDMRERVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0066707_106901872 | 3300005556 | Soil | MGEHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066704_106241012 | 3300005557 | Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066704_107603892 | 3300005557 | Soil | MRNHVLLFCLLSLVLTATIILVTAPEAVTWALSLIE* |
Ga0066705_100281012 | 3300005569 | Soil | MAVGMGERVLFFCLVGLLFTAAIILMIAPGSVTWALSFIQ* |
Ga0066691_106942582 | 3300005586 | Soil | MREHVLLFCLLGLVLTAAIILVIAPGTVTWALSLMID* |
Ga0066706_108127972 | 3300005598 | Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALSLIE* |
Ga0066905_1000803186 | 3300005713 | Tropical Forest Soil | MRERVLLLCLLGLLLTATIILVIAPGAVTWALALIE* |
Ga0066905_1001127591 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALVE* |
Ga0066905_1001248092 | 3300005713 | Tropical Forest Soil | MRHHVLLFCLVGLLLMAAIILIVAPGSVTLAVSLIE* |
Ga0066905_1001407845 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILATAPGAVIWALALIE* |
Ga0066905_1001475975 | 3300005713 | Tropical Forest Soil | MREHVLVFCLLGLVLIATILLVTAPGAVTWALALIE* |
Ga0066905_1001509634 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATTILVIAPGAVTWALALVE* |
Ga0066905_1002028825 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWALSLID* |
Ga0066905_1002245992 | 3300005713 | Tropical Forest Soil | MREQVLLFCLLGLVLTATIILVIAPGAVIWALALIE* |
Ga0066905_1002270403 | 3300005713 | Tropical Forest Soil | MREHVLLFCPLGLVLTAAIILVIAPGAVTWALALIE* |
Ga0066905_1002808144 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIILVTAPGAVTWALALIE* |
Ga0066905_1003220901 | 3300005713 | Tropical Forest Soil | MREQVLLFCLLGLVFTAVIMLAIAPGAVTWALALIE* |
Ga0066905_1003443673 | 3300005713 | Tropical Forest Soil | MREHLLLFCLLGLVLTATIILAVAPGAVTWALSLID* |
Ga0066905_1003866692 | 3300005713 | Tropical Forest Soil | LCSCTKGTDMREHVLLFCLLGLVLTAAMMLAVAPGAVTWALALIE* |
Ga0066905_1004179631 | 3300005713 | Tropical Forest Soil | IGTDMREHVLLFCLVGLVLIAVIMLLIAPGEVTWALSLIE* |
Ga0066905_1005193023 | 3300005713 | Tropical Forest Soil | MRDHVLTFCLLGLLLMAVVILIIAPGPVTWALSLVE* |
Ga0066905_1005318372 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID* |
Ga0066905_1005559443 | 3300005713 | Tropical Forest Soil | MATKPARFEHVLLFCLLGLVLTATILLVTAPGAVTRALSLIE* |
Ga0066905_1005724532 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD* |
Ga0066905_1005849643 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066905_1005965311 | 3300005713 | Tropical Forest Soil | MREHMLLFCLLGLVLAIAIMLVIQPGAVTWAVGLIE* |
Ga0066905_1006585951 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIMLVIAPGAVTWALALFE* |
Ga0066905_1006824831 | 3300005713 | Tropical Forest Soil | MREHVLLFSLLGLVLTATIVLAIAPGAVTWALSLID* |
Ga0066905_1006892841 | 3300005713 | Tropical Forest Soil | REHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0066905_1007653891 | 3300005713 | Tropical Forest Soil | MREHVLLFFLLGLVLIATIILVIAPGAVTWALSLIE* |
Ga0066905_1010516891 | 3300005713 | Tropical Forest Soil | MREHVLLFCPLGVVLTATIILVIAPGAVTWALALIE* |
Ga0066905_1011359482 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWTLAFIE* |
Ga0066905_1011432622 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLVE* |
Ga0066905_1011458102 | 3300005713 | Tropical Forest Soil | MREHVILFSLLGLVLTATIMLVTAPGAVTWALAFIE* |
Ga0066905_1011604821 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLLLTAVIMLMIAPGAVTWALSLIE* |
Ga0066905_1011799323 | 3300005713 | Tropical Forest Soil | TDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID* |
Ga0066905_1013392382 | 3300005713 | Tropical Forest Soil | LAVREHILLFGVLALLLMAAIILMVATGPVTWALSLID* |
Ga0066905_1014219812 | 3300005713 | Tropical Forest Soil | TDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066905_1014228543 | 3300005713 | Tropical Forest Soil | GTDMREHVLLFCLLGLVLTATIILAIAPGAVTWALSLID* |
Ga0066905_1016820033 | 3300005713 | Tropical Forest Soil | MREQVLLFCLLGLVLTAAIMLAVAPGAVTWALALIE* |
Ga0066905_1017147742 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILAIAPGAVTWALSLID* |
Ga0066905_1017155561 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0066905_1017742802 | 3300005713 | Tropical Forest Soil | EHVLLFFLLGLLLAAAIMLMVAPGSVTWALSFIQ* |
Ga0066905_1018372932 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLAIAIMLVIEPGAVTWAVGLIE* |
Ga0066905_1019322872 | 3300005713 | Tropical Forest Soil | MRNRVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDE |
Ga0066905_1019479541 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD* |
Ga0066905_1020188151 | 3300005713 | Tropical Forest Soil | MATKPPRFEHVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0066905_1020420962 | 3300005713 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLID* |
Ga0066905_1022454581 | 3300005713 | Tropical Forest Soil | MREHALLFCLLGLVLTAAIILVIAPGAVTWALALIE* |
Ga0066903_1000087428 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLAATIVLVTAPKAVTWALALIE* |
Ga0066903_1000243093 | 3300005764 | Tropical Forest Soil | MDERALLFCLLGLVLTVAILLAVAPSAVTWAMSFVE* |
Ga0066903_1000922635 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVVAPGAVTWALALIE* |
Ga0066903_1001010283 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLAATIILVTAPGAVTWALSLIE* |
Ga0066903_1001126006 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIE* |
Ga0066903_1002308062 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIILVVAPGAVTWALALIE* |
Ga0066903_1002390606 | 3300005764 | Tropical Forest Soil | MLREHVLLVCLLGLVFTATIILMAAPGAVTWALALIE* |
Ga0066903_1002566206 | 3300005764 | Tropical Forest Soil | MREYVLLFCLVGLVLIATILLVTEPAAVTWALALVE* |
Ga0066903_1002612791 | 3300005764 | Tropical Forest Soil | GTDMREHVLLCCLLGLVLTATILLVTAPGAVTWALALIE* |
Ga0066903_1002926882 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0066903_1003986202 | 3300005764 | Tropical Forest Soil | MRERIFLFCLLGLVLTATIILVIAPGAVTWTLAFIE* |
Ga0066903_1004933133 | 3300005764 | Tropical Forest Soil | MRERMLLFCLLGLVLTVAILMAVAPSVVTWALALIE* |
Ga0066903_1004996387 | 3300005764 | Tropical Forest Soil | MDERALLVCLLGLVLTAAIILAVAPGAVTWAMSLVE* |
Ga0066903_1005380902 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0066903_1005813382 | 3300005764 | Tropical Forest Soil | MREHAFLFCLLGLVLIATIILVIAPGAVTWALALIA* |
Ga0066903_1006175351 | 3300005764 | Tropical Forest Soil | REHVLLFCLLGLVFTATIILVTAPEAVTWALSLVE* |
Ga0066903_1006429162 | 3300005764 | Tropical Forest Soil | LCTEGTDMHEHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0066903_1007033375 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTVTIILVIAPGAVTWALALIE* |
Ga0066903_1007124424 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLTTTIILVIAPWAVTWALALIE* |
Ga0066903_1007183076 | 3300005764 | Tropical Forest Soil | MREHLFLICPLGLVLTATIILVAAPGAVTWALALIE* |
Ga0066903_1007268174 | 3300005764 | Tropical Forest Soil | MDERALLFCLLGLVLTAAIILAVAPGAVTWAMSLVE* |
Ga0066903_1007334834 | 3300005764 | Tropical Forest Soil | MREHVLLLCLLGLVLAATVMLVTAPGAVTWALALIE* |
Ga0066903_1007665863 | 3300005764 | Tropical Forest Soil | MRERMLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066903_1008330873 | 3300005764 | Tropical Forest Soil | MREYVFLFCLLGLVLIATILLLTEPAAVTWALALI* |
Ga0066903_1008462005 | 3300005764 | Tropical Forest Soil | MGEHVLLFCLLGLVLTATIILVIAPWAVTGTLALFE* |
Ga0066903_1009546262 | 3300005764 | Tropical Forest Soil | MREYVLLFCLLGLVLTAATILAIAPTAVTWALALVETQLVLLF* |
Ga0066903_1009571324 | 3300005764 | Tropical Forest Soil | MRKHVLLFCLLGLVLAITIMLVIEPGAVTWAVGLIE* |
Ga0066903_1009614284 | 3300005764 | Tropical Forest Soil | MRERMLLFCLLGLVLTVTIILVIAPWAVTGTLALVE* |
Ga0066903_1010334552 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIVLVTAPGEVTWALSLTE* |
Ga0066903_1011231812 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVFTATIILVTAPEAVTWALSLVE* |
Ga0066903_1011856885 | 3300005764 | Tropical Forest Soil | MREQVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066903_1013528102 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLIASILLVTEPAAVTWALALVE* |
Ga0066903_1013726443 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATILLVIAPGAVTWTLALIE* |
Ga0066903_1013939103 | 3300005764 | Tropical Forest Soil | MRERMLLFCLLGLVLTVTILMAVAPGAVTWALALIE* |
Ga0066903_1016313384 | 3300005764 | Tropical Forest Soil | MREHVLLFCPLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066903_1016676853 | 3300005764 | Tropical Forest Soil | MREQVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0066903_1017131442 | 3300005764 | Tropical Forest Soil | MREHVLLFCLFGLVLIATILLVTEPAAVTWALALVE* |
Ga0066903_1017371301 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLTATIMLAVAPGAVTWALAFIE* |
Ga0066903_1018619833 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLIATILLVTEPAAVTWALGLVE* |
Ga0066903_1019037063 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATILLVIAPGAVTWALALIE* |
Ga0066903_1019839942 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILMTAPGAVTWALALIE* |
Ga0066903_1020103971 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLAITIMLVIEPGAVTWAVGLV |
Ga0066903_1022133551 | 3300005764 | Tropical Forest Soil | MREHVLLFCLAGLVLIAAIMLLIAPGEVTWALSLIE* |
Ga0066903_1022269801 | 3300005764 | Tropical Forest Soil | FCFCTKGTDMRERVLLFCPLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066903_1024725662 | 3300005764 | Tropical Forest Soil | MREYVLLFCLLGLVLVAAIILVTEPAAVTWALALVE* |
Ga0066903_1024931233 | 3300005764 | Tropical Forest Soil | SDFVLSDMREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE* |
Ga0066903_1025190904 | 3300005764 | Tropical Forest Soil | RFRTKGTDMRERVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0066903_1026198641 | 3300005764 | Tropical Forest Soil | FCFCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0066903_1027218662 | 3300005764 | Tropical Forest Soil | SDMREHVLLFCLLGLVLTATIILVTAPGAVTWALALVE* |
Ga0066903_1027868153 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWTLSLIE* |
Ga0066903_1028656991 | 3300005764 | Tropical Forest Soil | MREHVFLFCLLGLVLIAVIMLLIAPEEVTWALSLIDEMT* |
Ga0066903_1029542763 | 3300005764 | Tropical Forest Soil | MREHVFLFCLLGVVLTATIMLVTAPEAVTWALALIE* |
Ga0066903_1029599911 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLIASILLVTEPAAVTWALTLVE* |
Ga0066903_1029606732 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIVLVTAPEAVTWALSLVE* |
Ga0066903_1029936983 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLISAIMLLIAPGEVTWALSLIE* |
Ga0066903_1035081223 | 3300005764 | Tropical Forest Soil | MHEHVLLFCLLGLVVIATIILVIAPGSVTWALALID* |
Ga0066903_1035154072 | 3300005764 | Tropical Forest Soil | MRERVLVFCLLGLVLTVTMILVIAPGAVTWALALIE* |
Ga0066903_1035218771 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLAITIMLVIEPGVVTWAVGLIE* |
Ga0066903_1035905392 | 3300005764 | Tropical Forest Soil | MREHLLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0066903_1036498512 | 3300005764 | Tropical Forest Soil | MRALLREHLLLFCLLGLVLTATIILAIAPGAVTSALSLID* |
Ga0066903_1036934612 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGTVTWALALID* |
Ga0066903_1039026094 | 3300005764 | Tropical Forest Soil | MRERVLLFSLLGLVLAITIMLVIEPRAVTWAVGLIE* |
Ga0066903_1040192452 | 3300005764 | Tropical Forest Soil | MATKPARFERLLLFCLLGLMLTATILLVTEPGAVTWALALIE* |
Ga0066903_1040681782 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVGLVLIAAIMLLIAPGEVTWALSLIDQMT* |
Ga0066903_1042679132 | 3300005764 | Tropical Forest Soil | MREHVLLFSLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066903_1042881751 | 3300005764 | Tropical Forest Soil | GTDMREHVLLFCLLGLVLIAAIMLLIAPGEVTWTLSLIE* |
Ga0066903_1043100781 | 3300005764 | Tropical Forest Soil | REHVLLFCLLGLVLTATIILVTAPEAVTWALSLVD* |
Ga0066903_1044000811 | 3300005764 | Tropical Forest Soil | MGEHVLLFCLLGLVLTATIMLVVAPGAVTWALALIE* |
Ga0066903_1044114532 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLMATIILVTAPGAVTWALALVD* |
Ga0066903_1044323962 | 3300005764 | Tropical Forest Soil | IGTDMREHVLLFCLLGLVLIAAIMLLIAPGEVTWTLSLID* |
Ga0066903_1044557621 | 3300005764 | Tropical Forest Soil | MREDVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0066903_1044789473 | 3300005764 | Tropical Forest Soil | MRERALLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0066903_1045383111 | 3300005764 | Tropical Forest Soil | VLSDMREHVLLFCLLGLVLTATIILVAAPGAVTWALSLIE* |
Ga0066903_1046213033 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILLIEPRAVTWAVGLIE* |
Ga0066903_1047532232 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALALME* |
Ga0066903_1047936912 | 3300005764 | Tropical Forest Soil | MGERVLLFCLAGLLLTAAILLMIAPGSVTWALSFIQ* |
Ga0066903_1048065071 | 3300005764 | Tropical Forest Soil | IGTDMREHVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIEGPY* |
Ga0066903_1048918172 | 3300005764 | Tropical Forest Soil | MAVGMGERVLFFCLVGLLLTAAIILMVAPGSVTWALSFIQ* |
Ga0066903_1050266543 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLALVLTATIILVVAPAAVTWALALIE* |
Ga0066903_1053011162 | 3300005764 | Tropical Forest Soil | MREHVLLFCLLGLVLTAAIMLLIAPGEVTWALSLIE* |
Ga0066903_1054175222 | 3300005764 | Tropical Forest Soil | MPERVLLFCLLGLVLTATIIMVAAPKAVTWALALIE* |
Ga0066903_1055817502 | 3300005764 | Tropical Forest Soil | IGTDMREHVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIG* |
Ga0066903_1057873362 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVFIASILLVTEPAAVTWALALVE* |
Ga0066903_1058014242 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLTATILLVTEPGAVTWALALIE* |
Ga0066903_1058361331 | 3300005764 | Tropical Forest Soil | AFVLSDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0066903_1059680552 | 3300005764 | Tropical Forest Soil | LCTKGTHMREHVLLFCLLGLVLAAAIMLLIAPGEVTWALSLIE* |
Ga0066903_1066950542 | 3300005764 | Tropical Forest Soil | MGERVLLFCLVGLLLTAVVILMIAPGSVTWALSFIQ* |
Ga0066903_1069898451 | 3300005764 | Tropical Forest Soil | SALATSNQGTDMREHVLLFCLLGLVLTVTMILVTAPGAVTWALALID* |
Ga0066903_1070080911 | 3300005764 | Tropical Forest Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0066903_1070983332 | 3300005764 | Tropical Forest Soil | LCTKGTDMREHVLLFCLFGLVLIATIILVTAPGAVTWALALID* |
Ga0066903_1071395102 | 3300005764 | Tropical Forest Soil | FCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0066903_1077508152 | 3300005764 | Tropical Forest Soil | MREHVFLFCLLGPVLTATIILAIAPGAVTWALSLID* |
Ga0066903_1080766061 | 3300005764 | Tropical Forest Soil | LTFRFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALSLIE* |
Ga0066903_1082302692 | 3300005764 | Tropical Forest Soil | EHVLLFCLLGLVFTATIILVTAPGAVTWALALIE* |
Ga0066903_1089732262 | 3300005764 | Tropical Forest Soil | MDERALLFCLLGLMLTVAILLAVAPSAVTWAMSFVE* |
Ga0066903_1090912583 | 3300005764 | Tropical Forest Soil | MREHVLLFCLVGLVLIAVIMLLIAPGEVTWALSLI |
Ga0066903_1091224102 | 3300005764 | Tropical Forest Soil | REHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE* |
Ga0066903_1091514922 | 3300005764 | Tropical Forest Soil | MRERMLLFCLLGLVLAATIILVIAPGAVTWAMALIE* |
Ga0070717_100267142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERVLLFCLLGLVLAATIMLVTAPKAVTWALALIE* |
Ga0070717_100605442 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHALLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0070717_100901873 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVVIATTILVIAPGVVTWALALIE* |
Ga0070717_104569792 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDMREHLFLFCPLGLVLTATIILVAAPGAVTWALAVIE* |
Ga0070717_112225882 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVLTATTILVVAPGAVTWALALIE* |
Ga0070717_118889331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHILLFGVLGLLLMAAIILMVAPGPVTWALSLID* |
Ga0070717_119627981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVFLYCLLGLVLTAAIILVIAPGTVTWALSLMID* |
Ga0066696_104717922 | 3300006032 | Soil | MREHVLLFFLLGLVLTATIMLVAAPGAVTWALAFIG* |
Ga0075365_102679863 | 3300006038 | Populus Endosphere | MREHVLLFFLLGLLLTAAIMLMIAPGSVTWALSFVQ* |
Ga0066652_1002920353 | 3300006046 | Soil | MRDHVLLFGLLGLLLLAVVMLIIAPGPVTWALSLIEP* |
Ga0066652_1009402212 | 3300006046 | Soil | MREHVLLICLLGLVLTAAIILAIAPGAVTWALALIE* |
Ga0075028_1000486943 | 3300006050 | Watersheds | MRDHVLLFCLLGVVLTATIILVIAPGTVTWALSLMID* |
Ga0070715_100325041 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLVGLVLTATIMLVTAPGAVTWALALID* |
Ga0075018_108620461 | 3300006172 | Watersheds | MREHVLLFCLLGLVLTATITLVTAPEAVTWALSLVE* |
Ga0070716_1003048734 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0070712_1000367372 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLVGLVLTATIMLVTAPGAVTWALALIE* |
Ga0070712_1000450632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERMLLFCLLGLVLAATIILVTAPGAVTWALALIE* |
Ga0070712_1000656935 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHALLFCLLGLVLTASIMLVAAPGAVTWALAFIE* |
Ga0079222_115559642 | 3300006755 | Agricultural Soil | MREHVLLFCLLGLVLTVTIILVTAPGAVTWALALIE* |
Ga0079222_119465602 | 3300006755 | Agricultural Soil | MRDHVLLLFCLLGLVLIAAIILVIAPGTVTWALSLMID* |
Ga0066659_101421532 | 3300006797 | Soil | MREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0066659_105152752 | 3300006797 | Soil | CTKGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID* |
Ga0075421_1014781152 | 3300006845 | Populus Rhizosphere | MGEHVLLFCLLGLVLTATIMLVAAPGAVTWALALIE* |
Ga0075433_114343722 | 3300006852 | Populus Rhizosphere | MREHVLLFCLLGLVFIATIILVIAPGAVTWALALIE* |
Ga0075425_1015168392 | 3300006854 | Populus Rhizosphere | MREHVLLFCLLGLVLTATIILVAAPGAVTWTLALIE* |
Ga0075425_1025812631 | 3300006854 | Populus Rhizosphere | MREHVLLFCLLGLVVIATTILVIAPGAVTWALALIE* |
Ga0075425_1026656792 | 3300006854 | Populus Rhizosphere | LTDMREYVLLVCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0075434_1010377251 | 3300006871 | Populus Rhizosphere | EHVLLFCLLGLVLTATIMLVAAPGAVTWALALIE* |
Ga0075434_1012944813 | 3300006871 | Populus Rhizosphere | MRERMLLYCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0075434_1015925161 | 3300006871 | Populus Rhizosphere | DMREHVLLFCLLGLVLTAVIMLAVAPGAVTWALALIE* |
Ga0075434_1018726892 | 3300006871 | Populus Rhizosphere | MGEHVLLFCLLGLVLTATIILVVAPGAVTFALSLVE* |
Ga0075424_1024537181 | 3300006904 | Populus Rhizosphere | MREHVLLFCLLGLVLTATIILVIAPGAVTWALALI |
Ga0066710_1006576853 | 3300009012 | Grasslands Soil | MREHALLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0111539_109125791 | 3300009094 | Populus Rhizosphere | ISAIGTDMREHVLLFCLLGLVLTAAIILVIAPGTVTWALSLMID* |
Ga0075418_120963191 | 3300009100 | Populus Rhizosphere | MRDHVFLFCLLGLLLMAAIILIIAPGPVTWALSLIE* |
Ga0114129_113520671 | 3300009147 | Populus Rhizosphere | MREHVLLFCLLGLVVVATVILVIAPGAVTWALALIE* |
Ga0114129_126847231 | 3300009147 | Populus Rhizosphere | DMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0075423_106191623 | 3300009162 | Populus Rhizosphere | MREHVLLFCLLGLVLTATIILVTAPGAVTWALVLID* |
Ga0075423_123880961 | 3300009162 | Populus Rhizosphere | EHILLFGVLALLLMAAITLMVAPGPVTLALSLID* |
Ga0105242_130849042 | 3300009176 | Miscanthus Rhizosphere | MPEHVLLFCLLGLVLTVTIILVTAPGAVTWALALIE* |
Ga0105242_133165812 | 3300009176 | Miscanthus Rhizosphere | MGEHVLLFCLLGLVLTATIMLVAAPGAVTWALAFIG* |
Ga0126374_100420073 | 3300009792 | Tropical Forest Soil | MRERVLLFCLLGLVLTATMILVAAPGAVTWALALIER* |
Ga0126374_100471785 | 3300009792 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE* |
Ga0126374_100485812 | 3300009792 | Tropical Forest Soil | LAVREHILLFSVLGLLLMAAIILMIAPGPVTWALSLID* |
Ga0126374_103097491 | 3300009792 | Tropical Forest Soil | MREYVLLFCLLGLVLIATILLVTEPAAVTWALALI* |
Ga0126374_104176681 | 3300009792 | Tropical Forest Soil | MREQVLLFCLRGLVLTATIILVTAPEAVTWALSLVE* |
Ga0126374_104360261 | 3300009792 | Tropical Forest Soil | MGAFAGVCTKGTDMREHVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0126374_105361031 | 3300009792 | Tropical Forest Soil | MREHVLLFCLLGLVLAATMILVTAPGAVTWALALIE* |
Ga0126374_110432772 | 3300009792 | Tropical Forest Soil | EGTDMREHVLLFCLLGLVLTATIILAIAPGAVTWALSLID* |
Ga0126374_113729842 | 3300009792 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWVLALIE* |
Ga0126380_101219794 | 3300010043 | Tropical Forest Soil | MREHVLLFCPLGVVLTATIILVAAPGAVTWAMGLIE* |
Ga0126380_106191541 | 3300010043 | Tropical Forest Soil | TKPPRFEHVLLFCLLGLVLTATILLVTAPGAVTWALSLIE* |
Ga0126380_107057162 | 3300010043 | Tropical Forest Soil | MREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID* |
Ga0126380_109225031 | 3300010043 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIILAIAPGAVTWALALSLID* |
Ga0126380_109728692 | 3300010043 | Tropical Forest Soil | MREHVLLFCLLALVLTATIILVIAPGAVTWALALIE* |
Ga0126380_110846262 | 3300010043 | Tropical Forest Soil | MRERVLLFCLLGLVITATIILVVAPGAVTWALALIE* |
Ga0126380_111567291 | 3300010043 | Tropical Forest Soil | MREYVLLFCLLGLVLIATILVLTEPAAVTWALALI* |
Ga0126380_118608261 | 3300010043 | Tropical Forest Soil | EHVFLFCLLGVVLTVTIMLVTAPEAVTWALGLIE* |
Ga0126380_119987072 | 3300010043 | Tropical Forest Soil | EGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0126384_1000869510 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWALALID* |
Ga0126384_100863415 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALID* |
Ga0126384_101727304 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATITLVIAPGAVTWALALME* |
Ga0126384_102107453 | 3300010046 | Tropical Forest Soil | MREHALLCCLLGLVLTAAMILVIAPGAVTWALALIE* |
Ga0126384_102699804 | 3300010046 | Tropical Forest Soil | MRERVLLFCLLGLVLTATIILVTAPGAVIWALALID* |
Ga0126384_103201331 | 3300010046 | Tropical Forest Soil | MREHVLLLCPLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126384_103261881 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALALIE* |
Ga0126384_103561963 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVVAPGAVTWALSLIE* |
Ga0126384_105405822 | 3300010046 | Tropical Forest Soil | MREHVFLFCLLGLVLTAAIILMTAPGAVTWALALIE* |
Ga0126384_105585952 | 3300010046 | Tropical Forest Soil | REHVLLFCLLGLVLTATITLVTAPGAVTWALALIE* |
Ga0126384_106991012 | 3300010046 | Tropical Forest Soil | FRFCTKGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0126384_107434291 | 3300010046 | Tropical Forest Soil | RERVLLFCLLGLVLTATIMLVTAPGAVTWALSLIE* |
Ga0126384_107559591 | 3300010046 | Tropical Forest Soil | AMREHVLLFCLLGLVLTATIILVIAPGAVTWTLAFIE* |
Ga0126384_107883851 | 3300010046 | Tropical Forest Soil | PNFCFCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0126384_108922551 | 3300010046 | Tropical Forest Soil | TDMREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE* |
Ga0126384_109437341 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVMAPGAVTWAVGLIE* |
Ga0126384_111888623 | 3300010046 | Tropical Forest Soil | VLSDMREHVLLFCLLGLVVIATTILVIAPGAVTWALALIE* |
Ga0126384_112573371 | 3300010046 | Tropical Forest Soil | DMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0126384_115737172 | 3300010046 | Tropical Forest Soil | MYEHVLLFCLLGLVLTATVILVIAPGAVTWALALIE* |
Ga0126384_119030411 | 3300010046 | Tropical Forest Soil | MREHVLLFFLLGLLLAAAIMLMVAPGSVTWALSFIQ* |
Ga0126384_120413091 | 3300010046 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWALTLIE* |
Ga0126384_120810402 | 3300010046 | Tropical Forest Soil | GTDMSEHVLLFCLLGLVLTATIILVIAPGAVTWALSLID* |
Ga0126384_124038751 | 3300010046 | Tropical Forest Soil | TDMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0126384_124238241 | 3300010046 | Tropical Forest Soil | REHVLLFCLLGLVLIATIILVTAPGAVTWALALIE* |
Ga0126382_101467172 | 3300010047 | Tropical Forest Soil | MRERVLLFCLFGLVLIATIILVTAPGAVTWALALFE* |
Ga0126382_103290442 | 3300010047 | Tropical Forest Soil | MPEHVLLFFLLGLLLAAAIMLMVAPGSVTWALSFIQ* |
Ga0126382_106816951 | 3300010047 | Tropical Forest Soil | SFCLCTKGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID* |
Ga0126382_109937581 | 3300010047 | Tropical Forest Soil | MRERVLLFCPLGLVLTATIILVIAPGAVTWALALIE* |
Ga0126382_114722521 | 3300010047 | Tropical Forest Soil | MREHALLFCLLGLVLTAAIILVIAPGAVTWALALI |
Ga0126382_115833901 | 3300010047 | Tropical Forest Soil | RERVLLFCLLGLVLTATIILVTAPGVVTWALALIE* |
Ga0126382_118297191 | 3300010047 | Tropical Forest Soil | LCTKGTDMREHVLLFCLLGLVLTATIILVMAPGAVTWAVGLIE* |
Ga0126382_123865591 | 3300010047 | Tropical Forest Soil | REHVLLFCLLGLVLTATIILVIAPGAVTWTLAFIE* |
Ga0126373_106049441 | 3300010048 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE* |
Ga0126373_110941582 | 3300010048 | Tropical Forest Soil | MRELVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIE* |
Ga0126373_111300451 | 3300010048 | Tropical Forest Soil | MREHVLLFCLLGLVLIVAIMLLIAPEEVTWALSLIDEMT* |
Ga0126373_113458801 | 3300010048 | Tropical Forest Soil | MRERVLLFGLLALVLTATILLVTAPGAVTWALSLIE* |
Ga0126373_123864581 | 3300010048 | Tropical Forest Soil | MRDNVLLFCLLDLVLIAAIMLLIAPGEVTWALSLIEGPY* |
Ga0126373_126622801 | 3300010048 | Tropical Forest Soil | TDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0099796_103910602 | 3300010159 | Vadose Zone Soil | MCTKGTDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126370_100572514 | 3300010358 | Tropical Forest Soil | MHEHVLLSSLLSLVLTATIILVTAPGAVTWTLALIE* |
Ga0126370_101255334 | 3300010358 | Tropical Forest Soil | SAFVLSDMREDVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0126370_101424592 | 3300010358 | Tropical Forest Soil | MREHVPLFCLLGLVLIAAIMLVIAPGAVTWTLALID* |
Ga0126370_102026153 | 3300010358 | Tropical Forest Soil | MRERVLLFCLLGLVLAATITLVTAPGAVTWALALIE* |
Ga0126370_110866031 | 3300010358 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALAVIE* |
Ga0126370_111991562 | 3300010358 | Tropical Forest Soil | MREHVLLFCLLGLVLMSAIMLLIAPGEVTWALSLIE* |
Ga0126370_112567492 | 3300010358 | Tropical Forest Soil | MRERVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD* |
Ga0126370_117404892 | 3300010358 | Tropical Forest Soil | MREHVLLCCLLGLVLTATILLVTAPGAVTWAIALIE* |
Ga0126370_117670451 | 3300010358 | Tropical Forest Soil | MRERVLLFCLLGLVLAATIILVIAPEAVTWALALIE* |
Ga0126370_121920173 | 3300010358 | Tropical Forest Soil | VLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0126370_123279892 | 3300010358 | Tropical Forest Soil | KSTDMRERMLLFCLLGLVLTATIILVVAPGAVTWALAPIE* |
Ga0126376_100147822 | 3300010359 | Tropical Forest Soil | MRDHVLLFGLLGLLLLAVVILIIAPGPVTWALSLID* |
Ga0126376_117602422 | 3300010359 | Tropical Forest Soil | MRERVLLFCLLGLVLTATIMLVAAPGAVTWALSLIE* |
Ga0126376_122929021 | 3300010359 | Tropical Forest Soil | MREHVLLFCLLGLVLTIILVIAPGAVTWALALIE* |
Ga0126376_126395902 | 3300010359 | Tropical Forest Soil | MREHVLLLFLLGLLLAAAIMLMVAPGSVTWALSFIQ* |
Ga0126376_130823162 | 3300010359 | Tropical Forest Soil | MREHVLLFCLLGLVLTATTILVIAPGAVTWALALIE* |
Ga0126372_101714761 | 3300010360 | Tropical Forest Soil | MREHVLLFCLLGLVLTAATILVIAPGAVTWALALVE* |
Ga0126372_103357732 | 3300010360 | Tropical Forest Soil | TDMREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0126372_103988632 | 3300010360 | Tropical Forest Soil | FCTKGTDVREHVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0126372_106723281 | 3300010360 | Tropical Forest Soil | MRERVLLFCLLGLVLTAAIILAIAPGAVTWALSLFD* |
Ga0126372_110403472 | 3300010360 | Tropical Forest Soil | MGEHVLLFCLLGLVLTATIILVIAPWAVTGTLALIE* |
Ga0126372_111568701 | 3300010360 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALVD* |
Ga0126372_131807191 | 3300010360 | Tropical Forest Soil | SDMREHVLLFCLLGLVLTATIILVAAPGAVTWALSLIE* |
Ga0126378_102321231 | 3300010361 | Tropical Forest Soil | MREHVLLFCLLGLVLIVAIMLLIAPGEVTWALSLIEGPY* |
Ga0126378_102523533 | 3300010361 | Tropical Forest Soil | MRERVLLFCLLGLVLTVTMILVIAPGAVTWALAPIE* |
Ga0126378_104789964 | 3300010361 | Tropical Forest Soil | GTDMRERVLLFCLSGLVLTATILLVTAPGAVTWALSLIE* |
Ga0126378_106102563 | 3300010361 | Tropical Forest Soil | MREHVLLFCLLGLVLAITIMLVIEPGAVTWAVGLVE* |
Ga0126378_108671035 | 3300010361 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIIPVTAPGAVTWALSLVE* |
Ga0126378_110543842 | 3300010361 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIILVTAPGAVTWALALIE* |
Ga0126378_111068491 | 3300010361 | Tropical Forest Soil | GTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0126378_115452551 | 3300010361 | Tropical Forest Soil | SFCLCTKGTDMREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID* |
Ga0126378_117483071 | 3300010361 | Tropical Forest Soil | MRERVLLFCPLGLVLTATIILATAPEAVTWALALIE* |
Ga0126378_120872442 | 3300010361 | Tropical Forest Soil | MREHVLLCCLLGQVLTATILLVTAPGAVTWALALIE* |
Ga0126378_123946831 | 3300010361 | Tropical Forest Soil | GTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALID* |
Ga0126378_127043211 | 3300010361 | Tropical Forest Soil | MRERVLLFCLLGLVLIATILLVTAPAAVTWALALIE* |
Ga0126378_128265562 | 3300010361 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0126378_129721892 | 3300010361 | Tropical Forest Soil | REHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT* |
Ga0126377_123441362 | 3300010362 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVIAPGAVTWALALIE* |
Ga0126377_124561502 | 3300010362 | Tropical Forest Soil | CTKGTDMREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE* |
Ga0126377_126049441 | 3300010362 | Tropical Forest Soil | STEMREHVLLFCLLGLALVATIILVTAPGAVTWALSLIE* |
Ga0126377_129537391 | 3300010362 | Tropical Forest Soil | NFCFCTEATDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126377_129800162 | 3300010362 | Tropical Forest Soil | AFVLKGTDVREHALLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126379_101299913 | 3300010366 | Tropical Forest Soil | MRERMLLFCLLGLVLTATIILVIAPGAVTWTLAFIE* |
Ga0126379_102316014 | 3300010366 | Tropical Forest Soil | MREHVLLFCLLGLVLTVTILLVTAPGAVTWALTLIE* |
Ga0126379_104962641 | 3300010366 | Tropical Forest Soil | MREHALLFCLLGLVLIATIMLVTAPGAVTWALALIE* |
Ga0126379_105946712 | 3300010366 | Tropical Forest Soil | MREHVLLFCLLGLVLTATTILAIAPGAVTWALSLID* |
Ga0126379_106065691 | 3300010366 | Tropical Forest Soil | MREHVLLFCPLGLVLTATIILVIEPRAVTWAVGLIE* |
Ga0126379_108681914 | 3300010366 | Tropical Forest Soil | LAVREHILLFSVLALLLMAAIILMVAPGPVTWVLSLID* |
Ga0126379_110521542 | 3300010366 | Tropical Forest Soil | FCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWTLALIE* |
Ga0126379_112906261 | 3300010366 | Tropical Forest Soil | FCTEGTDMRERVLLFCLLGLVLIASILLVTEPAAVTWALALVE* |
Ga0126379_115755181 | 3300010366 | Tropical Forest Soil | FCFCTKRTEMREHVLLFCLLGLVLTATIILVAAAPGAVTWALALIE* |
Ga0126379_116236031 | 3300010366 | Tropical Forest Soil | MRERVLLFCLLGLVLTATILLVTEPGAVTWALSFIE* |
Ga0126379_116626211 | 3300010366 | Tropical Forest Soil | NFRFCTRGADMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE* |
Ga0126379_120102671 | 3300010366 | Tropical Forest Soil | SRMDERALLFCLLGLVLTAAIILAVAPGAVTWAMSLVE* |
Ga0126379_120935322 | 3300010366 | Tropical Forest Soil | HDMREHVLLFCLLGLVLIAAIMLLIAPEEVTWTLSLIE* |
Ga0126379_121330662 | 3300010366 | Tropical Forest Soil | DMREHVLLFCLLGLVLIAAIMLLIAPAEVTWALSLIDSVMS* |
Ga0126379_129467381 | 3300010366 | Tropical Forest Soil | MGERVLLFCLVGLLLTAAILLMIAPGSVTWALSFIQ* |
Ga0134128_128206271 | 3300010373 | Terrestrial Soil | MREHVLLFFLVGLLLTAAIMLMVAPASVTWALSFIH* |
Ga0126381_1005880582 | 3300010376 | Tropical Forest Soil | MCEHVPLFCLLGLVLIAAIMLVIAPGAVTWTLALID* |
Ga0126381_1008826683 | 3300010376 | Tropical Forest Soil | LAVREHILLFGVLGLLLMAAIILMVAPGPVTWALSLID* |
Ga0126381_1009591312 | 3300010376 | Tropical Forest Soil | VREHALLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126381_1009610992 | 3300010376 | Tropical Forest Soil | MGERVLLFCLVGLLLTAAIMLMIAPGSVTWALSFIQ* |
Ga0126381_1010198772 | 3300010376 | Tropical Forest Soil | REHVLLFCLLGLVLTATIILVTAPGAVTWALSLVE* |
Ga0126381_1014153401 | 3300010376 | Tropical Forest Soil | MRERVLLFCLLGLVLTATILLVIAPGAVTWALALI |
Ga0126381_1020751902 | 3300010376 | Tropical Forest Soil | LNFCFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWTLALIE* |
Ga0126381_1038204791 | 3300010376 | Tropical Forest Soil | DMRERVLLFCLLGLVLTATILLVIAPGAVTWAVALIE* |
Ga0126381_1044836751 | 3300010376 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIILMTAPGAVTWALALIE* |
Ga0126381_1046611722 | 3300010376 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDQMT* |
Ga0126381_1050114542 | 3300010376 | Tropical Forest Soil | TKGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE* |
Ga0126383_102514812 | 3300010398 | Tropical Forest Soil | MREHVLLFCLSGLVLTATIILVTAPGAVTWALPLIE* |
Ga0126383_103409431 | 3300010398 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0126383_105296722 | 3300010398 | Tropical Forest Soil | MREHVLLFCLLGVVLTATIILVIAPGAVTWALALIE* |
Ga0126383_108765092 | 3300010398 | Tropical Forest Soil | MRERVLLFCLLGLVLTATMILVAAPGAVTWALALIE* |
Ga0126383_109368002 | 3300010398 | Tropical Forest Soil | CTKGTDMREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID* |
Ga0126383_118667173 | 3300010398 | Tropical Forest Soil | MRDHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID* |
Ga0126383_121175592 | 3300010398 | Tropical Forest Soil | LLFCLLGLVLIAAIMLLIAPAEVTWALSLIDSVMS* |
Ga0126383_126604242 | 3300010398 | Tropical Forest Soil | RFCTEGTDMRERVLLFCLLGLVLTATILLVIAPGAVTWAVALIE* |
Ga0126383_127043251 | 3300010398 | Tropical Forest Soil | MREHVLLFCLLGLVLTAAIILVTAPGAVTWALALIE* |
Ga0126383_128858541 | 3300010398 | Tropical Forest Soil | MREHVLLFCLLGLVLAATMILATAPGAVTWALALIE* |
Ga0126383_128933671 | 3300010398 | Tropical Forest Soil | FRFCTEGTDMREHVLLFCLLGLVLTATIMLVIAPGAVTWALALIE* |
Ga0126383_132174881 | 3300010398 | Tropical Forest Soil | DMRERMLLFCLLGLVLTVTILMAVAPGAVTWALALIE* |
Ga0126383_135559771 | 3300010398 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPAAVTSALALIE* |
Ga0126383_136296601 | 3300010398 | Tropical Forest Soil | ERVLLFGLLGLLLTAAIIMAVAPGAVTWAMSLVV* |
Ga0134122_101649371 | 3300010400 | Terrestrial Soil | REHVLLFFLVGLLLTAAIMLMVAPASVTWALSFIQ* |
Ga0124850_10014116 | 3300010863 | Tropical Forest Soil | MREHVLLFSLLGLVLTATIILVAAPGAVTWALALIG* |
Ga0124850_10074161 | 3300010863 | Tropical Forest Soil | MREQVLLFCLVGLVFTAAIILAIAPGAVTWALALIE* |
Ga0124850_11096261 | 3300010863 | Tropical Forest Soil | MREQVLLFCLLGLVLTATILLGTAPGAVTWALSLIE* |
Ga0120191_100010724 | 3300012022 | Terrestrial | MRDHVLLFGLLGLLLLAVVILIIAPGPVTWALSLIE* |
Ga0120191_100434952 | 3300012022 | Terrestrial | MGGRAILFCLLGLLLTAVITMMIAPQAVTWALSLIQ* |
Ga0137383_109533341 | 3300012199 | Vadose Zone Soil | MREHAFLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0137383_109716431 | 3300012199 | Vadose Zone Soil | MREHVLLFCLLGLVVIATIILVVAARAVTWAMALID* |
Ga0137383_113143801 | 3300012199 | Vadose Zone Soil | TDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0137382_100794992 | 3300012200 | Vadose Zone Soil | MREHVLLFCLLSLVLTATIILVTAPGAVTWALSLIE* |
Ga0137382_109435152 | 3300012200 | Vadose Zone Soil | MLEHVLLFCLLGLVLTVTIILVTAPGAVTWALALIE* |
Ga0137382_109511681 | 3300012200 | Vadose Zone Soil | RYHVPLFCLLGLVLMAAAFLIIAPGSVTWALSLIG* |
Ga0137365_100969561 | 3300012201 | Vadose Zone Soil | MRDHVLLFCPLGLVLTAAIMLVIAPGTVTWALSLM* |
Ga0137365_101463925 | 3300012201 | Vadose Zone Soil | MRDHVLLFGLLGLLLLAVVMLIIAPGPVTWALSLIE* |
Ga0137363_101921943 | 3300012202 | Vadose Zone Soil | MGEHMLLFCLLGLVLTATIILVAAPGAVTWALAFIG* |
Ga0137374_101667434 | 3300012204 | Vadose Zone Soil | MRDHVLLFGLLGLLLLAVAILIIAPGPVTWALSLIE* |
Ga0137374_102033155 | 3300012204 | Vadose Zone Soil | MRDHVLLFCPLSLVLTATIILVIAPGTVTWALSLMID* |
Ga0137381_101253476 | 3300012207 | Vadose Zone Soil | MREHVLLICLLGLVLTAAIILAIAPGAVTWALDQP |
Ga0137381_113720992 | 3300012207 | Vadose Zone Soil | MREHVLLFCLLGLVLTAAIILVIAPGTVTWVLSLMIG* |
Ga0137376_111380253 | 3300012208 | Vadose Zone Soil | MREHVLLFCLLGVVLTPTIMLVIAPGTVTWALSLMID* |
Ga0137379_101629832 | 3300012209 | Vadose Zone Soil | MREHVLLFCLLGLVLTAAFILVIAPGTVTWALSLMID* |
Ga0137379_102828171 | 3300012209 | Vadose Zone Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLMID* |
Ga0137379_105363431 | 3300012209 | Vadose Zone Soil | MREHVLLFCLLGLVLTAAITLVSAPGTVTWALSLMID* |
Ga0137378_105077242 | 3300012210 | Vadose Zone Soil | GTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0137377_113509241 | 3300012211 | Vadose Zone Soil | MREHVLLICLLGLVLTAAIILVMAPGTVTWALSLM |
Ga0137377_115870641 | 3300012211 | Vadose Zone Soil | KGTDMREHVLLFCLLGLVLTATITLVTAPEAVTWALSLVE* |
Ga0137366_105641651 | 3300012354 | Vadose Zone Soil | MRNHVLLFGLLSLLLLAVAILIIAPGPVTWALSLIE* |
Ga0137368_102002893 | 3300012358 | Vadose Zone Soil | MRDHVLLFCPLSLVLTATIILVLAPGTVTWALSLMID* |
Ga0137368_109941631 | 3300012358 | Vadose Zone Soil | MREHVLLFCLLGLVLTATIILVIAPGTVTWALSLMID* |
Ga0137385_116351422 | 3300012359 | Vadose Zone Soil | MRDHVLLFCLLGLVVTATIILVIAPGTVTWALSLMIG* |
Ga0137375_109148271 | 3300012360 | Vadose Zone Soil | IGTDMRDHVLLFCPLSLVLTATIILVIAPGTVTWALSLMID* |
Ga0137375_109762201 | 3300012360 | Vadose Zone Soil | LPMRDHVLLFCLMGLLLTAAIILIIAPGHVTWALSLIE* |
Ga0137358_101385361 | 3300012582 | Vadose Zone Soil | MREHVLLICLVGLLLTAAIILIVAPGSVTWALSFIE* |
Ga0137358_103527892 | 3300012582 | Vadose Zone Soil | MPEHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0137359_106517961 | 3300012923 | Vadose Zone Soil | TDMGEHVLLFCLLGLVLTATIIQVTAPGAVTWALALIE* |
Ga0137407_108389432 | 3300012930 | Vadose Zone Soil | FCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLMID* |
Ga0137407_122614781 | 3300012930 | Vadose Zone Soil | KGTDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE* |
Ga0126375_103833021 | 3300012948 | Tropical Forest Soil | MREHALLLCLLGLVLAATVMLVTAPGTVTWALALVD* |
Ga0126375_104357571 | 3300012948 | Tropical Forest Soil | PAPTCAFVLGGTDMREHVLLFCLLGLVLTATMILAIAPGAVTWALSLID* |
Ga0126375_104419063 | 3300012948 | Tropical Forest Soil | CTEGTDMREHVLLFCLLGLVLTATIILVTAPGAMTWALALIE* |
Ga0126375_107507032 | 3300012948 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAITLVTAPGAVTWALSLIE* |
Ga0126375_110499111 | 3300012948 | Tropical Forest Soil | MDERALLFCLLGLLLTVAILLAVAPSAVTWAMSFVE* |
Ga0126375_111230961 | 3300012948 | Tropical Forest Soil | MREHILLFSVLALLLMAAIILMVAPGPVTWALSLID |
Ga0126375_112077272 | 3300012948 | Tropical Forest Soil | MASKPARFVFERVLLFCLLGLVVTATILLVAAPGAVTWALSLIE* |
Ga0126375_113332761 | 3300012948 | Tropical Forest Soil | MREHVLLFCPLGLVLTATILLVAAPGAVTWALALIE* |
Ga0126375_118783741 | 3300012948 | Tropical Forest Soil | SSMDERALLFGLLGLLLTAAIILAVAPGAVTWAMSLVV* |
Ga0126375_119004631 | 3300012948 | Tropical Forest Soil | SLNLCSCTKGTDMREQVLLFCLLGLVLTATIVLVAAPGAVTLALIE* |
Ga0126375_120563101 | 3300012948 | Tropical Forest Soil | RLNFCCEGTEMREHVLLFCLLGLVLIATIILVTAPGAVTWALALID* |
Ga0164300_108710031 | 3300012951 | Soil | MGEHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE* |
Ga0164298_100984811 | 3300012955 | Soil | ADMREHVLLFCLLGLVLTATITLVTAPEAVTWALSLVE* |
Ga0164302_109924122 | 3300012961 | Soil | MREHVLLFCLLGLVLTATIILVTAPGTVTWALSLIE* |
Ga0126369_109043361 | 3300012971 | Tropical Forest Soil | MCTKGTDMREHVLLFCLLGLVLTATIILVVAPGAVTWALALIE* |
Ga0126369_111014171 | 3300012971 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVIAGAVTWALALIE* |
Ga0126369_116236802 | 3300012971 | Tropical Forest Soil | CTKGADMRERVLLFCLLGLVLSAMILLVTAPGAVTWALSLIE* |
Ga0126369_118499971 | 3300012971 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE* |
Ga0126369_120038412 | 3300012971 | Tropical Forest Soil | VLLFCLLGLVLIAAIMLLIAPGEVTWALSLLEGPP* |
Ga0126369_123278471 | 3300012971 | Tropical Forest Soil | MREHVLLFCLLGLVLTTTIILVTAPGAVTWALALIE* |
Ga0126369_125013351 | 3300012971 | Tropical Forest Soil | SFCLCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE* |
Ga0126369_126252981 | 3300012971 | Tropical Forest Soil | MREQVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE* |
Ga0126369_130608931 | 3300012971 | Tropical Forest Soil | GTDVRERVLLFCLLGLVLTATIILVIAPGAVTWALALIE* |
Ga0126369_132408181 | 3300012971 | Tropical Forest Soil | MREHVLLFCLLGLVLIVAIMLLIAPGEVTWALSLIE* |
Ga0126369_135072302 | 3300012971 | Tropical Forest Soil | MREHLLLFCLLGLVLTATIILVTAPGAVTWALALI |
Ga0164305_113878591 | 3300012989 | Soil | MHVLLFCLPGLVLTAMIILVTAPGAVTWALALIE* |
Ga0157378_132388852 | 3300013297 | Miscanthus Rhizosphere | MREHVLLFCLPGLVLTAMIILVTSPGAVTWALALIE* |
Ga0157379_118115761 | 3300014968 | Switchgrass Rhizosphere | MREHVLLFCLLGLVLTAVIMLAVAPGAVTWALALIE* |
Ga0132258_127825912 | 3300015371 | Arabidopsis Rhizosphere | MREHVLLFCLLGLVLTATIILVIAPGAVTWALAALIT* |
Ga0132256_1034562781 | 3300015372 | Arabidopsis Rhizosphere | MREHVLLFFLVGLLLTVAIMLMIAPGSVTWALSFVQ* |
Ga0132255_1000922091 | 3300015374 | Arabidopsis Rhizosphere | QAAIGVGMREHVLLFCLLGLLLTAAIMLMIAPGSVTWALSFIQ* |
Ga0182036_102241311 | 3300016270 | Soil | MREHVLLLCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0182036_104766971 | 3300016270 | Soil | MREHVLLFCLLGLVLIATITLVTAPGAVTWALSLIE |
Ga0182036_110668812 | 3300016270 | Soil | MREHVLLFCLLGLVLTATIILAIAPGAVTCALALIE |
Ga0182036_113241831 | 3300016270 | Soil | KGTDMREHVLLFCLLGLVLTATIILVAAQGAVTWALALIE |
Ga0182036_117042992 | 3300016270 | Soil | TFLTFRFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0182036_119062511 | 3300016270 | Soil | HVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0182041_104200812 | 3300016294 | Soil | GTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALALVE |
Ga0182041_105781303 | 3300016294 | Soil | GTDVREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0182041_107903622 | 3300016294 | Soil | DMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0182041_108594142 | 3300016294 | Soil | MREHVLIFCLLGLVLIAAIMLLLAPGEVTWALSLIE |
Ga0182041_113653581 | 3300016294 | Soil | TRGTDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALID |
Ga0182041_121114011 | 3300016294 | Soil | MREHVLLFCLLGLVLAGTIILVIALGAVTWALALIE |
Ga0182033_101291024 | 3300016319 | Soil | MDERALLFCLLGLVLTAAIILAVAPGAVTWTMSLVE |
Ga0182033_108781752 | 3300016319 | Soil | CFCTNGTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0182033_108827611 | 3300016319 | Soil | DGMDERALLFCLLGLVLTAAIILAVAPEAVTWTMSLVE |
Ga0182033_113662512 | 3300016319 | Soil | CTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0182035_118468212 | 3300016341 | Soil | MREHVLLFCLLGLVLTATIVLVTAPGAVTWALAFIECAAPAGRVPQWRSVRAHSTCR |
Ga0182035_120798601 | 3300016341 | Soil | RGAMREHVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE |
Ga0182032_103517211 | 3300016357 | Soil | SDMREHVLLFCLLGLVLTATIILVTAPKAVTWALALIE |
Ga0182032_105444042 | 3300016357 | Soil | FCTRGTDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALID |
Ga0182032_109648313 | 3300016357 | Soil | REHLFLFCLLGLVLTATIILVTALGAVTWALALIE |
Ga0182034_111766411 | 3300016371 | Soil | RFCTEGTDMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0182034_116580602 | 3300016371 | Soil | CTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE |
Ga0182034_116735181 | 3300016371 | Soil | GADMREHVLLFGLLGLVLTATITLVAAPEAVTWALSLVQ |
Ga0182040_103620734 | 3300016387 | Soil | FCFCTKGTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0182040_106787513 | 3300016387 | Soil | MREHVLLLCLTGLVLIAAIMLLIAPAEVTWALSLIE |
Ga0182040_108490833 | 3300016387 | Soil | TKGTDMREHVLLFCLLGLVLTAAIMLLIAPGEVTWALSLIE |
Ga0182040_113086131 | 3300016387 | Soil | MGEHVLLFCLLGLVLTATVILVIAPGAVTWALALIE |
Ga0182037_101530213 | 3300016404 | Soil | FCTKGTDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0182037_102714341 | 3300016404 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWALALID |
Ga0182037_104008731 | 3300016404 | Soil | LSFRFCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0182037_108586051 | 3300016404 | Soil | MREYVFLFCLLGLVLIATILLLTEPAAVTWALALI |
Ga0182037_110817002 | 3300016404 | Soil | MREHVLLFCLLGLVLTAAIMLAVAPGAVTWALSLFD |
Ga0182037_111084111 | 3300016404 | Soil | REHVLLFCLLGLVLAATIILVVAPGAVTWALGLIE |
Ga0182037_116385882 | 3300016404 | Soil | VLRGTMREHVLLFCLWGLVLTATIILVTAPGAVTWALSLVE |
Ga0182037_119145091 | 3300016404 | Soil | MREHVLLFCLLGLVLTATIILMIAPGAVTWALALIG |
Ga0182039_109467161 | 3300016422 | Soil | TDMREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0182039_110088101 | 3300016422 | Soil | PYAGTDMRELVLLFCLLGLVGLVAIMLLIAPEEVTWALSLIDEMT |
Ga0182039_113634102 | 3300016422 | Soil | SSHSLLLFGLLGLLLVGLIVLIVAPEHLTWALSFIV |
Ga0182039_120583312 | 3300016422 | Soil | MREHVFLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0182038_104475671 | 3300016445 | Soil | DMREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0182038_104790751 | 3300016445 | Soil | MRDHMFLFCLVGLVLIAALVLLLAPAEVTWALSLIEGPP |
Ga0182038_109575111 | 3300016445 | Soil | MREHVFLFCLVGLVLIVAIMLLIAPGEVTWALSLV |
Ga0066667_100462032 | 3300018433 | Grasslands Soil | MRERVLLFCLLGLVLAATIMLVTAPKAVTWALALIE |
Ga0066662_103944242 | 3300018468 | Grasslands Soil | MREHVLLFFLLGLVLTATIMLVAAPGAVTWALAFIG |
Ga0066662_123121552 | 3300018468 | Grasslands Soil | MRDHVLLFCLLGLLLIAAIILVIAPGPVTSALSLIE |
Ga0210399_104409281 | 3300020581 | Soil | MREHVLLFCLLGLLLTAVIILMVAPGSVTWALSFIE |
Ga0210384_116250111 | 3300021432 | Soil | MREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0210392_105046231 | 3300021475 | Soil | MGEHVLLFCLLGLVLTATIILVAPGAVTGALALIE |
Ga0126371_102055803 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0126371_102175892 | 3300021560 | Tropical Forest Soil | MRERMLLFCLLGLMLTATIILVVAPGAVTWALALIE |
Ga0126371_102179754 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0126371_103356664 | 3300021560 | Tropical Forest Soil | MREHVLLFCLSGLVLIATIILVTAPGAVTWALALIE |
Ga0126371_105140182 | 3300021560 | Tropical Forest Soil | MGERVLLFCLVGLLLTAAIMLMIAPGSVTWALSFIQ |
Ga0126371_105986524 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIILVTAPGAVTWALALIE |
Ga0126371_106662111 | 3300021560 | Tropical Forest Soil | MRDHVLLFCLVGLVLIAAIVLLVAPGEVTWALALIEGPP |
Ga0126371_106842324 | 3300021560 | Tropical Forest Soil | ISAIGADMREHVLLFCLLSLVLTATIILVTAPEAVTWALSLVE |
Ga0126371_107798262 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLAAAIMLLIAPGEVTWALSLIE |
Ga0126371_109169742 | 3300021560 | Tropical Forest Soil | MRDNVLLFCLLDLVLIAAIMLLIAPGEVTWALSLIEGPY |
Ga0126371_109321502 | 3300021560 | Tropical Forest Soil | MREQVLLFCLLGLVLTATILLVTAPGAVTWALSLIE |
Ga0126371_109379432 | 3300021560 | Tropical Forest Soil | MRELVLLFCLLGLVGLVAIMLLIAPEEVTWALSLIDEMT |
Ga0126371_112193461 | 3300021560 | Tropical Forest Soil | MREYVLLFCLVGLVLIATILLVTEPAAVTWALALVE |
Ga0126371_112534791 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLMSAIMLLIAPGEVTWALSLIE |
Ga0126371_112716002 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEM |
Ga0126371_114134251 | 3300021560 | Tropical Forest Soil | KGTDMREHVLLFCLLGLVITATIILVTAPGAVTWALALIE |
Ga0126371_114720701 | 3300021560 | Tropical Forest Soil | MRERVLLLCLLGLLLTATIILVIAPGAVTWALALIE |
Ga0126371_114941731 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0126371_115034252 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIMLVAAPGAVTGALALIE |
Ga0126371_116645852 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLAATIILMTAPGAVTWALALIE |
Ga0126371_118696502 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWVLALIE |
Ga0126371_121271041 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0126371_121889261 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0126371_124127281 | 3300021560 | Tropical Forest Soil | TDMREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0126371_125591701 | 3300021560 | Tropical Forest Soil | MAMKPARFERVLLFCLLGLVLTITIMLVIEPRAVTWAVGLIE |
Ga0126371_126890982 | 3300021560 | Tropical Forest Soil | MREHVLLFCLLGLVLIAAIMLLIAPAEVTWALSLIDSVMS |
Ga0126371_136274882 | 3300021560 | Tropical Forest Soil | GTAMRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0126371_136688592 | 3300021560 | Tropical Forest Soil | MGEHVLLFCLLGLVLTATIILVIAPWAVTGTLALIE |
Ga0126371_138133301 | 3300021560 | Tropical Forest Soil | LRAPTMRELVLLFCLVGLVLIATIILVTTPGAVTWVLALIE |
Ga0207684_100280157 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVVIATTILVIAPGVVTWALALIE |
Ga0207684_101039602 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVLTATIILVTAPGTVTWALSLIE |
Ga0207684_102681611 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVLTATIILVAAPGAVTWTLALIE |
Ga0207693_104917432 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCFCLLGLVLTATIILVAAPGAVTWALALI |
Ga0207646_102639004 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MREHVLLFCLLGLVLTATIILVAAPGAVTWVLALIE |
Ga0207646_112992871 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERVLLFCLLGLVLTATIILVAALGAVTWALALIE |
Ga0207700_120189211 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EATDMGEHVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0207665_109674961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TEAADMPEHALLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0207665_115079551 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDHVLLFCLLGVVLTPTIILVIAPGTVTWALSLMID |
Ga0209468_11194551 | 3300026306 | Soil | FCTEATDMGEHVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0209239_11458482 | 3300026310 | Grasslands Soil | MREHVLLFRLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0209153_10237672 | 3300026312 | Soil | MAVGMGERVLFFCLVGLLLTAAIILMIAPGSVTWALSFIQ |
Ga0209648_103070752 | 3300026551 | Grasslands Soil | MRDHVLLFCLLGLVVTATIILVSAPGTVTWVLSLMIG |
Ga0179593_11179221 | 3300026555 | Vadose Zone Soil | MREHVLLFCLLGLVLTATILLVAAPGAVTWTLALIE |
Ga0208210_1006862 | 3300026683 | Soil | MREHVLLFCLLGLLLTAAIMLMIAPGSVTWALSFIQ |
Ga0209214_10022473 | 3300027071 | Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALGLIE |
Ga0209731_10090131 | 3300027326 | Forest Soil | GEHVLLFCLLGLVLTATIMLVAAPGAVTWALALIE |
Ga0209622_10235173 | 3300027502 | Forest Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALGLI |
Ga0209003_10017091 | 3300027576 | Forest Soil | MREHVLLFCLLGLLLTATIILVTAPGAVTWALSLIE |
Ga0209466_10050094 | 3300027646 | Tropical Forest Soil | MREHVLLFCLLGLVLTATIILVMAPGAVTWAVGLIE |
Ga0209799_10632762 | 3300027654 | Tropical Forest Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0209465_101277793 | 3300027874 | Tropical Forest Soil | DMREHVFLFCLLGLVLTATTILAIAPGAVTWALSLID |
Ga0209465_102208732 | 3300027874 | Tropical Forest Soil | NFCLCTEGTDMREHVLLFCLLGLVLIATIILVTAPGVVTWAVALIE |
Ga0209465_104022241 | 3300027874 | Tropical Forest Soil | MRERVLLFCLLGLVLAATITLVTAPGAVTWALALIE |
Ga0209465_106833792 | 3300027874 | Tropical Forest Soil | FCTRGADMREHVLLFCLLGLVLTATIILVAAPGAVTWTLALIE |
Ga0209488_100922414 | 3300027903 | Vadose Zone Soil | MGEHMLLFCLLGLVLTATIILVAAPGAVTWALAFIG |
Ga0209488_102146242 | 3300027903 | Vadose Zone Soil | MREHVLLICLVGLLLTAAIILIVAPGSVTWALSFIE |
Ga0307278_101474061 | 3300028878 | Soil | VVSFASAIGMREHVLLLCLLGLLLAGVIILMIAPGSVTWALSFIE |
Ga0307304_103040362 | 3300028885 | Soil | MREHVLLFFLVGLLLTVAIMLMVAPASVTLALSFIQ |
Ga0170820_172434553 | 3300031446 | Forest Soil | MAMREHILLFGVLGLLLMAAIILMVAPGPVTWALSLID |
Ga0318516_100047789 | 3300031543 | Soil | MREHVLLFCLLGLVLTAAIILMIAPGAVTWALALIE |
Ga0318516_100099523 | 3300031543 | Soil | MREHMLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0318516_100165082 | 3300031543 | Soil | MREQVLLFCLLGLVLTAAIMLAVAPGAVTWALALIE |
Ga0318516_100268378 | 3300031543 | Soil | MREHLLPFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0318516_100282793 | 3300031543 | Soil | MRERVLLFCLLGLVLTVTMILVIAPGAVTWALALID |
Ga0318516_100377302 | 3300031543 | Soil | MREHVLLFCLLGLVLIATIVLVIAPGAVTWALALVE |
Ga0318516_100849344 | 3300031543 | Soil | MREHVLLFCLLGLVLTATIILVIAPGAVTWALSLID |
Ga0318516_100925692 | 3300031543 | Soil | MRERVLLFCLLGLVLIATIILVTAPGAVTWTLALID |
Ga0318516_101274172 | 3300031543 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIE |
Ga0318516_101685212 | 3300031543 | Soil | MREHALLFCLLGLVLAITIMLVIEPGAVTWAVGLIE |
Ga0318516_101812752 | 3300031543 | Soil | MRERVLLFCLLGLVLTATIMLVTAPGAVTWALSLIE |
Ga0318516_102402661 | 3300031543 | Soil | MREPVLLFCVLGLMLTATIILVIAPGAVTWALALIE |
Ga0318516_102697881 | 3300031543 | Soil | MRERVLLFCLLGLVLTATLILVTAPGAVTWALSLIE |
Ga0318516_102740152 | 3300031543 | Soil | MRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0318516_103043031 | 3300031543 | Soil | LHPPTKGTEMREHVLLFCLLGLVLAATIILMIAPGAVTWALALIE |
Ga0318516_104964881 | 3300031543 | Soil | MREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0318516_105089913 | 3300031543 | Soil | MRERVLLFCLLGLVFIATMILVTAPGAVIWALALIE |
Ga0318516_105431261 | 3300031543 | Soil | EGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318516_105850041 | 3300031543 | Soil | MREHVLLFCLLGLVLTATIILVIAPGALTWALALIE |
Ga0318534_101950783 | 3300031544 | Soil | MREHVLLFCLLGLVLIATIILVTAPGTVIWALALIE |
Ga0318541_100301914 | 3300031545 | Soil | MDERALLFCLLGLVLTAAIILAVAPEAVTWTMSLVE |
Ga0318541_100330855 | 3300031545 | Soil | MREHVLLFCLVGLVLIAGIMLLIAPGEVTWALSLIEGPP |
Ga0318541_100342777 | 3300031545 | Soil | DMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0318541_100547282 | 3300031545 | Soil | MRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0318541_100567732 | 3300031545 | Soil | MREHVLLFCLLGLVLTATIILVTAPKAVTWALALIE |
Ga0318541_100796702 | 3300031545 | Soil | MREHALLFCLLGLVLTATIILVTAPGALTWALALIE |
Ga0318541_100804613 | 3300031545 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLID |
Ga0318541_100924644 | 3300031545 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEIT |
Ga0318541_100924781 | 3300031545 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0318541_101513011 | 3300031545 | Soil | MRERVLLFCLLGLVLIATILLVTAPAAVTWALALIE |
Ga0318541_102517613 | 3300031545 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWAVALIE |
Ga0318541_102609292 | 3300031545 | Soil | NKGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318541_105220651 | 3300031545 | Soil | MRERVLLFCLLGLVLTATIILVTAPAAVTSALALIE |
Ga0318541_105337201 | 3300031545 | Soil | DMREHVLLFCLLGLVLIATIMLVTAPGAVTWALALIE |
Ga0318541_106098463 | 3300031545 | Soil | MRERMLLFCPLGLVLTATIILVIAPGAVTWALAFIE |
Ga0318541_106251391 | 3300031545 | Soil | MRERMLLFCLLGLVLTATIILVIAPEAVTWALSLIE |
Ga0318541_106537692 | 3300031545 | Soil | MCEHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318541_106850761 | 3300031545 | Soil | MDERALLFCLLGLVLTAAIILAVAPGAVTWAMSLVE |
Ga0318541_107158851 | 3300031545 | Soil | IGGDMREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0318538_1000559310 | 3300031546 | Soil | MRERVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0318538_100114026 | 3300031546 | Soil | MREHVLLFCLLGLVLTATIILLIEPRAVTWAVGLIE |
Ga0318538_100448324 | 3300031546 | Soil | MREHLLLFCLLGLVLAATIILMIAPGAVTWALALIE |
Ga0318538_101076866 | 3300031546 | Soil | TDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0318538_101244601 | 3300031546 | Soil | FRFCTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0318538_101262121 | 3300031546 | Soil | MREHVLLSCLVGLVLTATIMLVTVPEAVTWALSLVE |
Ga0318538_106617521 | 3300031546 | Soil | MREHVLLFCLLGLVLTATILLVAAPGAVTWALALIE |
Ga0318571_100331061 | 3300031549 | Soil | IGTDMREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318528_103441582 | 3300031561 | Soil | VREHVLLFCLLGLVLAGTIILVIAPGAVTWALALIE |
Ga0318528_107875162 | 3300031561 | Soil | TFRFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0318573_100432305 | 3300031564 | Soil | MRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0318573_102587641 | 3300031564 | Soil | TDVREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0318573_104096793 | 3300031564 | Soil | CEGTEMREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0318573_104588292 | 3300031564 | Soil | NFCFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318573_107241691 | 3300031564 | Soil | AIGIDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0318515_100679292 | 3300031572 | Soil | TDMREHVLLFCLLGLVLTAAIILMIAPGAVTWALALIE |
Ga0310915_100475304 | 3300031573 | Soil | MREHVFLFCLVGLVLIVAIMLLIAPGEVTWALSLVEGPP |
Ga0310915_100814395 | 3300031573 | Soil | RTKGTDMREHVLLFCLLGLVLTAAIMLLIAPGEVTWALSLIE |
Ga0310915_101851301 | 3300031573 | Soil | MHEHVLLSCLLSLVLTATILLVTAPGTVTSALSLI |
Ga0310915_102523942 | 3300031573 | Soil | KGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0310915_102819211 | 3300031573 | Soil | TKGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWAPSLIE |
Ga0310915_103029532 | 3300031573 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALID |
Ga0310915_103682521 | 3300031573 | Soil | MREHVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0310915_104300392 | 3300031573 | Soil | MREHVLLFCLLGLVLAATIILVVAPGAVTWALGLIE |
Ga0310915_104340013 | 3300031573 | Soil | REHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0310915_104538332 | 3300031573 | Soil | MREHVLLFCLLGVVLTATIILVTAPGAVTWALSLIE |
Ga0310915_104701521 | 3300031573 | Soil | EGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0310915_105569292 | 3300031573 | Soil | MREHVLLFCLFGLVLIATILLVTEPAAVTWALALVE |
Ga0310915_105902851 | 3300031573 | Soil | MREHVLLFCLLGLVGLVLITAIMLLIAPGEMTWALSLIDEMT |
Ga0310915_108970041 | 3300031573 | Soil | REHVLLFSLLGLVLTATIILAIAPGAVTWALSLID |
Ga0318555_101985201 | 3300031640 | Soil | MRERVLLFCLLGLVLTATILLVTAPEAVTWALALIE |
Ga0318555_104753141 | 3300031640 | Soil | DMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0318555_105837411 | 3300031640 | Soil | TKGTRMRERVLLFCLLGLVLIATIILVTAPGAVTWTLALID |
Ga0318542_102682131 | 3300031668 | Soil | MGHLTKGTDVRQHVLLFCLLGLVLAGTIILVIAPGAVTWALALIE |
Ga0318542_103071482 | 3300031668 | Soil | MRERVLLFCLLGLVLTATILLVIAPGAVTWALALIG |
Ga0318542_103579742 | 3300031668 | Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWALSLV |
Ga0318542_104393361 | 3300031668 | Soil | RERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0318574_102954432 | 3300031680 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0318574_105065211 | 3300031680 | Soil | GTDMREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0318574_109328702 | 3300031680 | Soil | CTEGTDMREHVLLFCLLGLVLIATIILVTAPGTVIWALALIE |
Ga0318572_102004341 | 3300031681 | Soil | RGTDMRERMLLFCPLGLVLTATIILVIEPGAVTWALAFIE |
Ga0318572_106131072 | 3300031681 | Soil | ADMRERVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0318560_103912202 | 3300031682 | Soil | TDMREHVLLFCLLGLVLTATIILVTAQGAVTWAVSLIE |
Ga0318560_104897141 | 3300031682 | Soil | GVNMHEHVLLSCLLSLVLTATILLVTAPGTVTSALSLIE |
Ga0318560_105748021 | 3300031682 | Soil | MREHVLLFCLLGLVLTAAMMLLIAPGEVTWALSLIE |
Ga0318496_104076112 | 3300031713 | Soil | TEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318496_104208531 | 3300031713 | Soil | MREHVLLFCLLALVLIATIILVTAPGAVTWAVALIE |
Ga0318496_104682611 | 3300031713 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALVF |
Ga0306917_100115362 | 3300031719 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWAVALIE |
Ga0306917_102730802 | 3300031719 | Soil | MREHVLLFCLLGLVLTATIVLVTAPGAVTWAPSLIE |
Ga0306917_103601311 | 3300031719 | Soil | FCLCTKGTDMREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID |
Ga0306917_107204003 | 3300031719 | Soil | MRERVLLFCLLGLVLTATLILVTAPGAVTWALSLI |
Ga0306917_107585392 | 3300031719 | Soil | FCTEGTDMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0306917_113686421 | 3300031719 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALIG |
Ga0306917_115834212 | 3300031719 | Soil | TEMREHVLLFCLLGLVLAATIMLVAAPGAVTGALALIE |
Ga0318493_108366461 | 3300031723 | Soil | TKGTDMREHMLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0318500_100422201 | 3300031724 | Soil | TFRFCTEGTDMRERVLLFCLLGLVLIATILLVTAPAAVTWALALIE |
Ga0318500_104361951 | 3300031724 | Soil | TKGTNMGEHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0318501_100179841 | 3300031736 | Soil | TRGTDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0318501_101563411 | 3300031736 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPAEVTWALSLIDEMT |
Ga0318501_101663252 | 3300031736 | Soil | MRERVLLFCLLGLVLTATILLVTAPGAVTWALSLIE |
Ga0318501_103840141 | 3300031736 | Soil | FCFCTKGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0306918_100441197 | 3300031744 | Soil | CTRGTDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0306918_100740843 | 3300031744 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWAVALE |
Ga0306918_100966355 | 3300031744 | Soil | NFCFCTKGTDMREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0306918_103984432 | 3300031744 | Soil | MGEHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0306918_108231221 | 3300031744 | Soil | FCFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0306918_108350331 | 3300031744 | Soil | MREGLLLFCLLGLVLTATIILVTAPGAVTWALALID |
Ga0306918_108494712 | 3300031744 | Soil | MRERVLLFCLLGLVLAATIILVTAPDAVTWALALIE |
Ga0306918_109358811 | 3300031744 | Soil | MREHVLLFCLLGLVLTATIILVMAPGAVTWALSLID |
Ga0306918_113283551 | 3300031744 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLI |
Ga0318502_100071641 | 3300031747 | Soil | REHVLLFCLLGLVLTATILLVAAPGAVTWALALIE |
Ga0318502_107682822 | 3300031747 | Soil | MREHVLLFCLLGLVLIATIMLVTAPGAVTWALALIE |
Ga0318492_106363622 | 3300031748 | Soil | DMREHVLLFCLLGLVLTATIILVTAPKAVTWALALIE |
Ga0318494_100311146 | 3300031751 | Soil | CTRGTDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALID |
Ga0318494_102010612 | 3300031751 | Soil | MREHVLLFCLMGLVLIAAIMLLLAPGEVTWALSLIEGPP |
Ga0318494_102139353 | 3300031751 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDE |
Ga0318494_106347351 | 3300031751 | Soil | DMREYVLLFCLVGLVLIATILLVTEPAAVTWALALVE |
Ga0318537_1000281611 | 3300031763 | Soil | MREHVLLFCLLGLVLTATIILVTAPEAVTWVLSLIE |
Ga0318535_100159184 | 3300031764 | Soil | IYQPQLCFCTEGTDMREHVLLFCLLGLVLIATIMLVTAPGAVTWALALIE |
Ga0318535_102515222 | 3300031764 | Soil | TDMRERVLLFCLLGLVLTATIILVTAPGAVTWAVALE |
Ga0318535_103111791 | 3300031764 | Soil | FCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0318535_104378401 | 3300031764 | Soil | TKGADMRERVLLFCLLGLVLTAAIMLAIAPEAVTWALSLFD |
Ga0318554_101828091 | 3300031765 | Soil | TKGTYMREHVLLFCLLGLVLTATIILVIAPGAVTWALSLID |
Ga0318526_104025341 | 3300031769 | Soil | RERVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0318546_105201812 | 3300031771 | Soil | EGWLTDMREHLFLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0318546_110557282 | 3300031771 | Soil | VLRDAMREHVLLFCLLGLVLTATIILVIAPGAVTWTLAFIE |
Ga0318566_102169592 | 3300031779 | Soil | MRERVLLFCLLGLVLIATILLVIAPGAVTWALALIE |
Ga0318508_11560361 | 3300031780 | Soil | RERVLLFCLLGLVLTATLILVTAPGAVTWALSLIE |
Ga0318547_102238721 | 3300031781 | Soil | EGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0318529_1000635810 | 3300031792 | Soil | MRERVLLFCLLGLVLTVTMILVIAPGAVTWALALI |
Ga0318529_100713084 | 3300031792 | Soil | TKGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0318529_104483092 | 3300031792 | Soil | GTRMRERVLLFCLLGLVLIATIILVTAPGAVTWTLALID |
Ga0318548_101146931 | 3300031793 | Soil | MREHVLLFCLVGLVLTATIMLVTVPEAVTWALSLVE |
Ga0318548_104088021 | 3300031793 | Soil | VSAIGADMREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0318503_100030752 | 3300031794 | Soil | MRNRVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318503_100096611 | 3300031794 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLID |
Ga0318503_102717091 | 3300031794 | Soil | FCTEGTDMRERVLLFCLLGLVLIATILLVTAPAAVTWALALIE |
Ga0318523_100541081 | 3300031798 | Soil | VREHVLLFCLLGLVLTATIILVIAPGAVTWALALI |
Ga0318523_102125411 | 3300031798 | Soil | FCTKGTDVREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0318523_103360851 | 3300031798 | Soil | LNFCFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWAVALIE |
Ga0318497_100744255 | 3300031805 | Soil | GTDMRERVLLFCLLGLVLIATILLVTAPAAVTWALALIE |
Ga0318497_102580842 | 3300031805 | Soil | MREYVILFCLVGLVLIATILLVTEPAAVTWALALVE |
Ga0318497_104853362 | 3300031805 | Soil | MREHVLLFCLLGLVLTATIILVAAPGAVTWALALI |
Ga0318497_108323441 | 3300031805 | Soil | RGPVLLFCVLGLMLTATIILVIAPGAVTWALALIE |
Ga0318568_104002402 | 3300031819 | Soil | TKGTDAREHVLLFCLLGLVLTATIILVTAPGAVTWAK |
Ga0318499_102689812 | 3300031832 | Soil | TDMREHVLLFCLLGLVLIATIMLVTAPGAVTWALALIE |
Ga0310917_101082165 | 3300031833 | Soil | MRCAQCVALVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0310917_101347003 | 3300031833 | Soil | MREHVLLFCLAGLVLIAAIMLLIAPREVTWALSLIE |
Ga0310917_101906042 | 3300031833 | Soil | MHEHVLLSCLLSLVLTATILLVTAPGTVTSALSLIE |
Ga0310917_107142753 | 3300031833 | Soil | GTDMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0310917_109052761 | 3300031833 | Soil | SAFVLSDMREGLLLFCLLGLVLTATIILVTAPGAVTWALALID |
Ga0318517_100933891 | 3300031835 | Soil | MREHVLLSCLVGLVLTATIILVTAPEAVTWALSLVE |
Ga0318517_102028533 | 3300031835 | Soil | MREYVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318511_101155491 | 3300031845 | Soil | CFCSEGTDMREYVLLFCLLGLVLIATILLVTEPAAVTWALALVE |
Ga0318511_101604653 | 3300031845 | Soil | MREHVLLFCLLGLVGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318511_102583722 | 3300031845 | Soil | MREHVLLFCLLGLVLMLLIAPEEVTWALSLIDEMT |
Ga0318527_100434451 | 3300031859 | Soil | PNFCFCTEGTDMREHVLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0318495_103641452 | 3300031860 | Soil | AIGTHMRDHVLLFCLVGLVLIAAIMLLLAPGEVTWALSLIEGPP |
Ga0306919_100274511 | 3300031879 | Soil | TDMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALID |
Ga0306919_101106605 | 3300031879 | Soil | MREHVLLFCLLGLVLTATIILVTAQGAVTWALSLIE |
Ga0306919_102405541 | 3300031879 | Soil | MREHLFLICPLGLVLTATIILVAAPGAVTWALALIE |
Ga0306919_102791351 | 3300031879 | Soil | CTKGTDMRERVLLFCLLSLVLTATILLVTAPGAVTWALSLIE |
Ga0306919_103681631 | 3300031879 | Soil | MREHVLLFCLLGLVLTAAIMLLIAPGEVTWALSLIE |
Ga0306919_105445471 | 3300031879 | Soil | FCTKGADMREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0306919_108954782 | 3300031879 | Soil | TNMREHMLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0306919_112735282 | 3300031879 | Soil | AIGADMREHVLLFCLLGLVLTATILLVAAPGAVTWALALIE |
Ga0306919_114120832 | 3300031879 | Soil | GISVISADMREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0306919_114905032 | 3300031879 | Soil | MRDHVLLFCLVDLVLIAAIMLLLAPGEVTWALSLIEGPP |
Ga0318544_100133294 | 3300031880 | Soil | MRERVLLFCLLGLVLTAAIMLAIAPEAVTWALSLFD |
Ga0318544_101015963 | 3300031880 | Soil | TKGTGMRERVLLFCLLGLVLTATLILVTAPGAVTWALSLIE |
Ga0318544_102920861 | 3300031880 | Soil | MRERVLLFCLLGLVLTATILLVTEPGAVTWALALIE |
Ga0306925_100095156 | 3300031890 | Soil | MCEHVFLFCLLGLVLTATIILVAAPGVVTWALALIE |
Ga0306925_104284712 | 3300031890 | Soil | MREPVLLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0306925_104944241 | 3300031890 | Soil | MRERMLLFCPLGLVLTATIILVIEPGAVTWALAFIE |
Ga0306925_105029692 | 3300031890 | Soil | MREHVLLFCLLGLVLTATILLVTAPGAVTLALSLIE |
Ga0306925_107000943 | 3300031890 | Soil | NMHEHVLLSCLLSLVLTATILLVTAPGTVTSALSLIE |
Ga0306925_107013831 | 3300031890 | Soil | MREHVLLFCLVGLVLIAAIMLLIAPGEVTWALSLIE |
Ga0306925_110214002 | 3300031890 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALALVE |
Ga0306925_111048032 | 3300031890 | Soil | MREQVFLFCLLGLVLTATILLVAAPGAVTWALSLVE |
Ga0306925_112987462 | 3300031890 | Soil | MREYVLLFCLLGLVLIATILVLTEPAAVTWALALI |
Ga0306925_115855591 | 3300031890 | Soil | MREHVLLFCLLGLVLTATIILVTAPGTVTWALALID |
Ga0318536_100160732 | 3300031893 | Soil | MREPVLLFCVLGLMLTATIILVIAPGAVTWALAVIE |
Ga0318536_100432005 | 3300031893 | Soil | TKGTDMRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0318522_104065652 | 3300031894 | Soil | AIGTDMREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318551_103914541 | 3300031896 | Soil | RTKGTDMRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0318551_105212041 | 3300031896 | Soil | CFCCEGTEMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318520_101308142 | 3300031897 | Soil | MREHVLLFCLLGLVLTATITLVTAPEAVTWALSLIE |
Ga0318520_101683413 | 3300031897 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWVVALIE |
Ga0318520_105734042 | 3300031897 | Soil | REHVLLFCLLGLVLTATIILVTAPGAVTWALALVE |
Ga0318520_108035901 | 3300031897 | Soil | MREPVLLFCLLGLVLTATIILVTAPGAVTWALAFIE |
Ga0306923_101353653 | 3300031910 | Soil | MREHVLLFCLLGLVLAATIILVAAPGAVTWALALIE |
Ga0306923_101439763 | 3300031910 | Soil | MRERVLLFCLLGLVLTATIILVTAPGAVTWAVALIK |
Ga0306923_101539126 | 3300031910 | Soil | GTDAREHVLLFCLLGLVLTATIILVTAPGAVTWAK |
Ga0306923_107572972 | 3300031910 | Soil | MHEHVLLSCLLSLVLTATIILVTAPGAVTWALALIE |
Ga0306923_111644161 | 3300031910 | Soil | CFCTKGTDMREHVLLFCLLGLVLIATIVLVIAPGAVTWALALVE |
Ga0306923_119786351 | 3300031910 | Soil | GTDMREHVLLFCLLGLVLTAAMMLLIAPGEVTWALSLIE |
Ga0306923_120473132 | 3300031910 | Soil | MRDNVFLFCLVGLVLIAAIMLLIAPGEVTWVLALIEGP |
Ga0306923_121743271 | 3300031910 | Soil | MREHVLLFCLLGLVLTATIVLAIAPGAVTWALSFID |
Ga0306923_123744962 | 3300031910 | Soil | MREHVLLFCLLGLVGLVLIAAIMLLIAPGEVTWALSLIDRIT |
Ga0306921_100770694 | 3300031912 | Soil | MREHVLLFCLLGLVLTATTILVTAPGAVTWALALIE |
Ga0306921_103788703 | 3300031912 | Soil | MREHVLLFCLLGLVLTATTILVIAPGAVTWALALIE |
Ga0306921_104509533 | 3300031912 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALIQ |
Ga0306921_120628772 | 3300031912 | Soil | NMGEHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0306921_120960002 | 3300031912 | Soil | MREHVLLFCLLGLVLTATIILVAAPGTVTWTLALIDELMSVS |
Ga0306921_121406932 | 3300031912 | Soil | IGTDMRDHVLLFCLVGLVLIAAIMLLLAPGEVTWALSLIEGPP |
Ga0306921_123543541 | 3300031912 | Soil | MREHVLLFCLLGLVLTATIILVAAPKAVTWALALIE |
Ga0306921_127337371 | 3300031912 | Soil | MREHVLLFCLLGLVLTATLILVIAPAAVTWALGLIE |
Ga0310912_101349501 | 3300031941 | Soil | GIDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0310912_104603513 | 3300031941 | Soil | TKGTDVREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0310916_101132463 | 3300031942 | Soil | MRERVLLFCLLSLVLTATILLVTAPGAVTWALSLIE |
Ga0310916_101267192 | 3300031942 | Soil | MREHVLLVCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0310916_110261051 | 3300031942 | Soil | LNFCFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0310916_110828591 | 3300031942 | Soil | HRLNFCFCSEGTDMREYVFLFCLLGLVLIATILLLTEPAAVTWALALI |
Ga0310916_111079091 | 3300031942 | Soil | FRFCTEGTDMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0310913_103349011 | 3300031945 | Soil | ICTKGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLIE |
Ga0310913_108596331 | 3300031945 | Soil | ASARGTDMREHVLLFCLLGLVLIAAIMLLIAPGEVTWALSLIE |
Ga0310910_101104156 | 3300031946 | Soil | TMREHVLLFCLLGLVLTATIILVTAPGAVTWALSLVE |
Ga0310910_106606523 | 3300031946 | Soil | GTDVREHVLLFCLLGLVLTATIILAIAPGAVTWALSLID |
Ga0310910_107220433 | 3300031946 | Soil | KGTDMRERMLLFCLLGLVLTATIILVIAPEAVTWALSLIE |
Ga0310909_100985406 | 3300031947 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALALVE |
Ga0310909_105827462 | 3300031947 | Soil | NFSFCTKGTAKRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0310909_107286573 | 3300031947 | Soil | MRELLLFCLLGLVLTATILLVAAPGAVTWALALIE |
Ga0310909_114088211 | 3300031947 | Soil | CTEGTDMRERVLLFCLLGLVLTATILLVIAPGAVTWALALIE |
Ga0306926_1006374610 | 3300031954 | Soil | MREHVCLFCLLGLVLTAAIILVTAPGAVTWARPLIE |
Ga0306926_101224266 | 3300031954 | Soil | MRELLLFCLLGLVLTATIILVTAPGAVTWALAHIE |
Ga0306926_101252249 | 3300031954 | Soil | MRDHVLLFCLLGLVGLVAIMLLIAPEEVTWALSLIDEMT |
Ga0306926_102547754 | 3300031954 | Soil | MREHVLLFCLLGLVLTATIILMIAPGAVTWALGDV |
Ga0306926_102832492 | 3300031954 | Soil | MREHVLLFCLLGLVLTATTILVTAPGAVTWALSLIE |
Ga0306926_109541911 | 3300031954 | Soil | KGTAKRERVLLFCLLGLVLTATILLVTAPGAVTWALALIE |
Ga0306926_119840521 | 3300031954 | Soil | MREYVLLFCLLGLVLIATILVLTEPAAVTWALAVI |
Ga0318530_100338241 | 3300031959 | Soil | REHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0318530_100959181 | 3300031959 | Soil | MRERVLLFCLLGLVLTAAIMLAIAPGAVTWALSLF |
Ga0318530_102481981 | 3300031959 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAVTWALSLI |
Ga0318530_102878662 | 3300031959 | Soil | CFCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALIE |
Ga0318530_104125602 | 3300031959 | Soil | FVLRGTMREHVLLFCLLGLVLTATLILVIAPAAVTWALGLIE |
Ga0318531_100739462 | 3300031981 | Soil | MREQVLLFFLLGLVLTAAIMLAVAPGAVTWALALIE |
Ga0306922_103147624 | 3300032001 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVTWALADYSL |
Ga0306922_108275542 | 3300032001 | Soil | TKGPNMREHVLLFCLLGLVLTATTILVIAPGAVTWALALIE |
Ga0306922_108659024 | 3300032001 | Soil | KGTDMREHVLLFCLLGLVLTATIILVTAPGAVTWALAHIE |
Ga0306922_109319291 | 3300032001 | Soil | ISAIGADMREQVFLFCLLGLVLTATILLVAAPGAVTWALSLVE |
Ga0306922_110493161 | 3300032001 | Soil | MREHVLLICLLGLVLTATIILAIAPGAVTWALSLID |
Ga0306922_123845972 | 3300032001 | Soil | MRERVLLFCLLGLVVTATILLVAAPGAVTWALALIE |
Ga0318569_103155832 | 3300032010 | Soil | NFCFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0318507_100279553 | 3300032025 | Soil | MREHVVLFCLLGLVLTAAIILMIAPGAVTWALALIE |
Ga0318507_101705153 | 3300032025 | Soil | FCFCTKGADMREHVLLFCLLGLVLTAAIMLAIAPGAVTWALSLFD |
Ga0310911_102557291 | 3300032035 | Soil | AFVLRGAMREHVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE |
Ga0318559_105968302 | 3300032039 | Soil | MREHVLLFCLLGLVLTATIILVTAPGAMTWALSLIE |
Ga0318549_100410801 | 3300032041 | Soil | MREHVLLFCLLGLVLIATIILVTAPGTVIWARALIE |
Ga0318549_101940863 | 3300032041 | Soil | MDERALLFCLLGLVLTAAIILAVAPEAVTWTMSLV |
Ga0318545_101234093 | 3300032042 | Soil | MREHVLLFCLLGLVGLVLIAAIMLLIAPGEVTWALSL |
Ga0318545_102656732 | 3300032042 | Soil | SFCFCTKGTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0318556_102534423 | 3300032043 | Soil | MREHVLLFCLLGLVGLVLIAAIMLLIAPGEVTWALSLIE |
Ga0318556_103795471 | 3300032043 | Soil | MRERVLLFCLLGLVLTATILLVTAPGAVTWALALI |
Ga0318558_102409451 | 3300032044 | Soil | MRERVLLFCLLGLVLTATILLVIAPAAVTWALALIE |
Ga0318533_100701401 | 3300032059 | Soil | EGTDMREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE |
Ga0318533_101699423 | 3300032059 | Soil | RERVLLFCLLGLVLTATIILVTAPGAVTWAVALIK |
Ga0318533_106221273 | 3300032059 | Soil | RERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE |
Ga0318533_108822892 | 3300032059 | Soil | TKGTDMRERMLLFCLLGLVLTATIILVIAPEAVTWALSLIE |
Ga0318533_112593182 | 3300032059 | Soil | MREHVLLFCLLGLVLIATIILVAAPGAVTWALAFIE |
Ga0318533_114011672 | 3300032059 | Soil | VREHVLLFCPLGLVLTATIILVIAPGAVTWALALI |
Ga0318533_114017671 | 3300032059 | Soil | MRERVLLFCLLSLVLTATILLVTAPGAVTWALSLI |
Ga0318533_114397262 | 3300032059 | Soil | MREHLFLFCLLGLVLTATIILVTAPGAVTWALALIE |
Ga0318505_102766011 | 3300032060 | Soil | VREHVLLFCLLGLVLTATILLVTAPGAVTWALSLI |
Ga0318505_105605662 | 3300032060 | Soil | FTFLTFRFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0318510_100109901 | 3300032064 | Soil | IDMREHVLLFCLLGLVLTATIILVAAPGAVTWALALIE |
Ga0318510_104478812 | 3300032064 | Soil | DMREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0318510_105182271 | 3300032064 | Soil | DMREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDEMT |
Ga0318524_101358373 | 3300032067 | Soil | TDMREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0318553_100627644 | 3300032068 | Soil | CCEGTEMREHVLLFCLLGLVLIATIILVTAPGAVTWALALVD |
Ga0318553_102894031 | 3300032068 | Soil | ILTFRFCTEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0306924_101129414 | 3300032076 | Soil | MREHVLLFCLLGLVLAATIILMIAPGAVTWALALIE |
Ga0306924_102563917 | 3300032076 | Soil | VRDHVLLFCLLGLVLTAVIMLAVAPGAVTWALALIE |
Ga0318518_107272981 | 3300032090 | Soil | FVLSDMREHALLFCLLGLVLTATIILVTAPGALTWALALIE |
Ga0318577_102779544 | 3300032091 | Soil | MRERVLLFCLLGLVLTATIMLVTAPGAVTWALSLIECAS |
Ga0318577_104055651 | 3300032091 | Soil | GTDVREHVLLFCLLGLVLTATIILAIAPGAVTWALALIE |
Ga0307470_117721022 | 3300032174 | Hardwood Forest Soil | TDMRERVLLIFLLGLVLTATIILVAAPGAVTWALALIE |
Ga0307472_1015084882 | 3300032205 | Hardwood Forest Soil | GVNMREHVLLFCLLGLALTATIILVAAPGAVTWALALIE |
Ga0306920_1000114828 | 3300032261 | Soil | MRDNVFLFCLVGLVLIAAIMLLIAPGEVTWVLALIEGPY |
Ga0306920_1003817932 | 3300032261 | Soil | MREHVLLFCLLGLVLAATLILVAAPGAVTWALALIE |
Ga0306920_1004441024 | 3300032261 | Soil | MREHVLLFCLLGLVLTATIVLVTAPGAVTWALALID |
Ga0306920_1005965013 | 3300032261 | Soil | REHVLLFCLLGLVLTATIILVIEPRAVTWAVGLIE |
Ga0306920_1006686732 | 3300032261 | Soil | MREHVLLFCLLGLVLIATIILVTAPGAVIWALALIE |
Ga0306920_1009485131 | 3300032261 | Soil | MREHVLLFCLLGLVLTATIILVAAQGAVTWALALIE |
Ga0306920_1014694562 | 3300032261 | Soil | MREHVLLFCLLGLVLTATIILVTAQGAVTWAVSLIE |
Ga0306920_1016773872 | 3300032261 | Soil | MREHVLLFGLLGLVLTATVILVTAPGAVTWALALIE |
Ga0306920_1019026841 | 3300032261 | Soil | MREHVLLFCLLGLVLTATVILVTAPGTVTWALALID |
Ga0306920_1029428761 | 3300032261 | Soil | DMRERVLLFCLLGLVLTATIILVTAPGAVTWAVALIK |
Ga0306920_1032503921 | 3300032261 | Soil | AIGADMREHVLLFCLLGLVLTATIIPVTAAEAVTWALSLVE |
Ga0306920_1044651291 | 3300032261 | Soil | MREHVLLFCLLGLVLIAAIMLLIAPEEVTWALSLIDELT |
Ga0310914_104878381 | 3300033289 | Soil | MRERVLLFCLLGLVLTAAIILAIAPGAVTWALSLID |
Ga0310914_107380431 | 3300033289 | Soil | DMRERVLLFCLLSLVLTATILLVTAPGAVTWALSLIE |
Ga0310914_107910702 | 3300033289 | Soil | TAGGGVSAIGADMREHVLLFCLLGLVLTATIILVTAPEAVTWALSLVE |
Ga0310914_110925741 | 3300033289 | Soil | TEGTDMREHVLLFCLLGLVLTATIVLVTAPGAVTWALALIE |
Ga0318519_101303494 | 3300033290 | Soil | TKGTDMREHVLLFCLLGLVLTATIILVIAPGAVTWALALIE |
Ga0318519_106040972 | 3300033290 | Soil | FCTEGTDMREHVLLFCLLGLVLIATIILVTAPGAVTWAVALIE |
⦗Top⦘ |