NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000953

Metagenome / Metatranscriptome Family F000953

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000953
Family Type Metagenome / Metatranscriptome
Number of Sequences 822
Average Sequence Length 148 residues
Representative Sequence MKFAVAALLGLVAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Number of Associated Samples 384
Number of Associated Scaffolds 822

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.73 %
% of genes near scaffold ends (potentially truncated) 74.70 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 356
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.878 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(44.161 % of family members)
Environment Ontology (ENVO) Unclassified
(73.844 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.482 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 44.57%    β-sheet: 13.59%    Coil/Unstructured: 41.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 822 Family Scaffolds
PF01070FMN_dh 0.12

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 822 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.12
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.12


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003303|Ga0006246J48908_1037925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300003677|Ga0008458J53046_101559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300005433|Ga0066830_10118000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300005608|Ga0066840_10137829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300005837|Ga0078893_10683543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium967Open in IMG/M
3300006357|Ga0075502_1007789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300006362|Ga0075508_149036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300006379|Ga0075513_1322670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300006384|Ga0075516_1380304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300006392|Ga0075507_1516794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300006399|Ga0075495_1445108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300006401|Ga0075506_1001752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300006728|Ga0031676_1404055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Aerococcaceae → Globicatella → Globicatella sulfidifaciens501Open in IMG/M
3300006728|Ga0031676_1431380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300007863|Ga0105744_1040458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1154Open in IMG/M
3300007863|Ga0105744_1069963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium865Open in IMG/M
3300007958|Ga0105743_1043064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300008833|Ga0103881_100386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300008929|Ga0103732_1015383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1056Open in IMG/M
3300008936|Ga0103739_1009551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1133Open in IMG/M
3300008936|Ga0103739_1062797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300008956|Ga0104261_1038564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300008958|Ga0104259_1020622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300008958|Ga0104259_1020784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300008958|Ga0104259_1033093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300008958|Ga0104259_1038636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300008993|Ga0104258_1015786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1399Open in IMG/M
3300008993|Ga0104258_1080171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300008993|Ga0104258_1113882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300008998|Ga0103502_10232636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300008998|Ga0103502_10242479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300008998|Ga0103502_10414932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300009006|Ga0103710_10092842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300009022|Ga0103706_10118782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300009025|Ga0103707_10036819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium823Open in IMG/M
3300009028|Ga0103708_100133789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009071|Ga0115566_10231192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1116Open in IMG/M
3300009172|Ga0114995_10151284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1295Open in IMG/M
3300009172|Ga0114995_10229158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1028Open in IMG/M
3300009172|Ga0114995_10305878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium875Open in IMG/M
3300009263|Ga0103872_1011937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium919Open in IMG/M
3300009263|Ga0103872_1024889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium760Open in IMG/M
3300009265|Ga0103873_1011600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1260Open in IMG/M
3300009265|Ga0103873_1097776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300009274|Ga0103878_1026479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300009276|Ga0103879_10016232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300009422|Ga0114998_10151721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1116Open in IMG/M
3300009422|Ga0114998_10212912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium916Open in IMG/M
3300009434|Ga0115562_1254760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300009436|Ga0115008_10293210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1155Open in IMG/M
3300009436|Ga0115008_10461621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300009495|Ga0115571_1132025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1058Open in IMG/M
3300009507|Ga0115572_10317251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium881Open in IMG/M
3300009508|Ga0115567_10254022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1116Open in IMG/M
3300009526|Ga0115004_10963119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300009543|Ga0115099_10075792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300009543|Ga0115099_10788655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium767Open in IMG/M
3300009592|Ga0115101_1175246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300009592|Ga0115101_1426535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium951Open in IMG/M
3300009593|Ga0115011_11727027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300009599|Ga0115103_1158594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300009599|Ga0115103_1541062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium942Open in IMG/M
3300009606|Ga0115102_10013478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009608|Ga0115100_10228496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300009608|Ga0115100_10650117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300009677|Ga0115104_10006387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300009677|Ga0115104_10038481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300009677|Ga0115104_10041535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300009677|Ga0115104_11018914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300009677|Ga0115104_11113359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300009679|Ga0115105_10849350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300009679|Ga0115105_10924491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300009679|Ga0115105_10936964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300009679|Ga0115105_11088489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300009705|Ga0115000_10384664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium896Open in IMG/M
3300009728|Ga0123371_174821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009730|Ga0123359_183330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300009732|Ga0123373_186236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300009735|Ga0123377_1013851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300009738|Ga0123379_1029539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300009741|Ga0123361_1059376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300009785|Ga0115001_10970878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300010981|Ga0138316_10075823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300010981|Ga0138316_10112436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300010981|Ga0138316_10475630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300010981|Ga0138316_10754854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300010981|Ga0138316_10849421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300010981|Ga0138316_10881975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300010981|Ga0138316_10883109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300010981|Ga0138316_11078953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300010981|Ga0138316_11307562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300010985|Ga0138326_10302977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300010985|Ga0138326_10889293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300010985|Ga0138326_11073887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300010985|Ga0138326_11391394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300010985|Ga0138326_11915169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300010987|Ga0138324_10138531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1076Open in IMG/M
3300010987|Ga0138324_10412181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300010987|Ga0138324_10428916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300010987|Ga0138324_10448627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300010987|Ga0138324_10451283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300010987|Ga0138324_10514173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300010987|Ga0138324_10520651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300010987|Ga0138324_10531069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300010987|Ga0138324_10609969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300010987|Ga0138324_10702741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300010987|Ga0138324_10705431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300010987|Ga0138324_10722173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300011312|Ga0138349_1094660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300012370|Ga0123369_1018177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300012394|Ga0123365_1322160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300012504|Ga0129347_1186427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300012518|Ga0129349_1036192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300012518|Ga0129349_1156529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300012518|Ga0129349_1157419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300012518|Ga0129349_1274827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300012518|Ga0129349_1338323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300012520|Ga0129344_1045682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300012523|Ga0129350_1155145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300012523|Ga0129350_1195051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300012523|Ga0129350_1217713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300012523|Ga0129350_1286204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300012523|Ga0129350_1345709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300012523|Ga0129350_1359207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300012525|Ga0129353_1670483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300012525|Ga0129353_1672428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300012525|Ga0129353_1914384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300012528|Ga0129352_10490691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300012528|Ga0129352_10634342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300012528|Ga0129352_10729467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300012528|Ga0129352_10994511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300012920|Ga0160423_10483834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium842Open in IMG/M
3300012954|Ga0163111_10449748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1178Open in IMG/M
3300016732|Ga0182057_1301941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300016737|Ga0182047_1046725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300016740|Ga0182096_1291629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300016751|Ga0182062_1277193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300017719|Ga0181390_1098502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium785Open in IMG/M
3300017719|Ga0181390_1101766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium767Open in IMG/M
3300017719|Ga0181390_1174317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300017724|Ga0181388_1063683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium883Open in IMG/M
3300017731|Ga0181416_1068877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium836Open in IMG/M
3300017745|Ga0181427_1103735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300017748|Ga0181393_1043728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1240Open in IMG/M
3300017749|Ga0181392_1075845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1016Open in IMG/M
3300017751|Ga0187219_1140987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300017751|Ga0187219_1143435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300017756|Ga0181382_1050643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1198Open in IMG/M
3300017772|Ga0181430_1174165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300017776|Ga0181394_1246805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300017779|Ga0181395_1059043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1256Open in IMG/M
3300017783|Ga0181379_1110659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1000Open in IMG/M
3300018418|Ga0181567_10684584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018502|Ga0193334_103727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018515|Ga0192960_104054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300018556|Ga0192942_104565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300018556|Ga0192942_105003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018567|Ga0188858_105533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300018575|Ga0193474_1013997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300018596|Ga0193060_1015923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300018596|Ga0193060_1020550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018596|Ga0193060_1021748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300018602|Ga0193182_1007413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium899Open in IMG/M
3300018618|Ga0193204_1008819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300018618|Ga0193204_1011801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300018625|Ga0192842_1012034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium881Open in IMG/M
3300018625|Ga0192842_1012142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium878Open in IMG/M
3300018625|Ga0192842_1022173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018625|Ga0192842_1033302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300018628|Ga0193355_1009112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium868Open in IMG/M
3300018628|Ga0193355_1013338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300018628|Ga0193355_1014308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300018628|Ga0193355_1017569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300018628|Ga0193355_1022065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018649|Ga0192969_1037189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300018649|Ga0192969_1042969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300018658|Ga0192906_1033264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018658|Ga0192906_1040830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300018661|Ga0193122_1051968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300018671|Ga0193571_1011944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018674|Ga0193166_1019375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018674|Ga0193166_1022176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018674|Ga0193166_1023870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300018692|Ga0192944_1022427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300018692|Ga0192944_1036347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300018692|Ga0192944_1037580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018692|Ga0192944_1039363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300018692|Ga0192944_1044721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300018699|Ga0193195_1039493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300018701|Ga0193405_1024587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300018701|Ga0193405_1031696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018701|Ga0193405_1033053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018716|Ga0193324_1035359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300018724|Ga0193391_1036109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018730|Ga0192967_1057795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018730|Ga0192967_1057796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300018730|Ga0192967_1058894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018735|Ga0193544_1020233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018735|Ga0193544_1023406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018741|Ga0193534_1045471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018742|Ga0193138_1030587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300018742|Ga0193138_1031093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018742|Ga0193138_1031189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018742|Ga0193138_1031751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300018742|Ga0193138_1032137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300018742|Ga0193138_1036862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018742|Ga0193138_1051614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300018742|Ga0193138_1052291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300018745|Ga0193000_1023835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300018745|Ga0193000_1032331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300018745|Ga0193000_1033553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300018745|Ga0193000_1035512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300018745|Ga0193000_1063101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300018746|Ga0193468_1045570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300018746|Ga0193468_1051692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300018746|Ga0193468_1063707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300018749|Ga0193392_1035602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300018761|Ga0193063_1070871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018762|Ga0192963_1056438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300018762|Ga0192963_1062169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018762|Ga0192963_1062170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018762|Ga0192963_1062183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018763|Ga0192827_1036488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium852Open in IMG/M
3300018763|Ga0192827_1053957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018763|Ga0192827_1055260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300018763|Ga0192827_1070246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018763|Ga0192827_1077700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300018763|Ga0192827_1078023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300018763|Ga0192827_1090231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300018763|Ga0192827_1090482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018763|Ga0192827_1092317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300018765|Ga0193031_1048478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018765|Ga0193031_1048795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018765|Ga0193031_1051070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018765|Ga0193031_1051554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300018765|Ga0193031_1055486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018765|Ga0193031_1060861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018765|Ga0193031_1066768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300018765|Ga0193031_1072896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300018765|Ga0193031_1076360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300018765|Ga0193031_1088271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300018765|Ga0193031_1094633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300018766|Ga0193181_1041901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018766|Ga0193181_1047840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300018766|Ga0193181_1053587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300018770|Ga0193530_1076881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300018771|Ga0193314_1063903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300018776|Ga0193407_1039916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300018779|Ga0193149_1041265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018779|Ga0193149_1051900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018782|Ga0192832_1044102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018782|Ga0192832_1053776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018782|Ga0192832_1058066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300018787|Ga0193124_1037695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300018787|Ga0193124_1045668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018787|Ga0193124_1059406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300018787|Ga0193124_1067259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300018791|Ga0192950_1041566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300018791|Ga0192950_1073773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300018796|Ga0193117_1058662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018800|Ga0193306_1030238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium847Open in IMG/M
3300018800|Ga0193306_1051265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300018800|Ga0193306_1058087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018801|Ga0192824_1076807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300018801|Ga0192824_1079181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018805|Ga0193409_1057636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300018805|Ga0193409_1062966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018812|Ga0192829_1072079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300018812|Ga0192829_1072427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018821|Ga0193412_1060119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300018823|Ga0193053_1049181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300018823|Ga0193053_1049460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300018823|Ga0193053_1049839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300018823|Ga0193053_1050363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300018823|Ga0193053_1050509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300018823|Ga0193053_1052400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300018823|Ga0193053_1054225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300018823|Ga0193053_1055170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018823|Ga0193053_1064273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018828|Ga0193490_1081096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300018830|Ga0193191_1052112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300018830|Ga0193191_1053953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300018831|Ga0192949_1075019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018831|Ga0192949_1084356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300018831|Ga0192949_1089402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018832|Ga0194240_1011246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300018832|Ga0194240_1013302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300018832|Ga0194240_1015992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018838|Ga0193302_1056040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018838|Ga0193302_1056071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018838|Ga0193302_1058235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018838|Ga0193302_1058678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300018838|Ga0193302_1063852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018838|Ga0193302_1066142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018838|Ga0193302_1087234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018842|Ga0193219_1045151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300018842|Ga0193219_1046886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018842|Ga0193219_1047585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300018842|Ga0193219_1077708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018844|Ga0193312_1067252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018846|Ga0193253_1058524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium950Open in IMG/M
3300018846|Ga0193253_1060298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium934Open in IMG/M
3300018846|Ga0193253_1086980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300018849|Ga0193005_1074613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018855|Ga0193475_1084136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018859|Ga0193199_1103071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018860|Ga0193192_1028654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300018860|Ga0193192_1028768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300018860|Ga0193192_1039108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300018861|Ga0193072_1063951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300018861|Ga0193072_1093646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018862|Ga0193308_1051953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300018862|Ga0193308_1052356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300018862|Ga0193308_1065472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300018862|Ga0193308_1066318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300018864|Ga0193421_1080167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018864|Ga0193421_1097659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018870|Ga0193533_1095199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300018880|Ga0193337_1034374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300018881|Ga0192908_10025678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018882|Ga0193471_1075791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018882|Ga0193471_1084518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300018885|Ga0193311_10064099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018893|Ga0193258_1191452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300018905|Ga0193028_1043404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium896Open in IMG/M
3300018905|Ga0193028_1049164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium841Open in IMG/M
3300018922|Ga0193420_10102338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300018926|Ga0192989_10111399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300018926|Ga0192989_10112830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018926|Ga0192989_10114416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018926|Ga0192989_10158717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018926|Ga0192989_10172846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300018928|Ga0193260_10090208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300018928|Ga0193260_10093573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300018928|Ga0193260_10098898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300018928|Ga0193260_10107102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300018930|Ga0192955_10111149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300018932|Ga0192820_10178100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300018942|Ga0193426_10086024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018942|Ga0193426_10086089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018948|Ga0192985_1196295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018955|Ga0193379_10158555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018961|Ga0193531_10241437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018964|Ga0193087_10235186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018967|Ga0193178_10040415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018967|Ga0193178_10041318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018967|Ga0193178_10056335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300018967|Ga0193178_10072082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300018967|Ga0193178_10074666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018967|Ga0193178_10075690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018968|Ga0192894_10316948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300018969|Ga0193143_10223019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300018974|Ga0192873_10292862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300018977|Ga0193353_10197630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300018977|Ga0193353_10223513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300018979|Ga0193540_10057523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1002Open in IMG/M
3300018979|Ga0193540_10073960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium912Open in IMG/M
3300018979|Ga0193540_10186896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300018980|Ga0192961_10170797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300018981|Ga0192968_10135171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018981|Ga0192968_10135172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018982|Ga0192947_10126375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium853Open in IMG/M
3300018982|Ga0192947_10169433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300018982|Ga0192947_10177180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium707Open in IMG/M
3300018986|Ga0193554_10339461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300018989|Ga0193030_10167630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300018989|Ga0193030_10173530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300018989|Ga0193030_10178488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300018989|Ga0193030_10181790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300018989|Ga0193030_10181796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300018989|Ga0193030_10182351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018989|Ga0193030_10182582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018989|Ga0193030_10201860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300018989|Ga0193030_10215158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300018989|Ga0193030_10222307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018989|Ga0193030_10229462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018989|Ga0193030_10230200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018989|Ga0193030_10252828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018989|Ga0193030_10253740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300018989|Ga0193030_10268408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300018989|Ga0193030_10288162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018989|Ga0193030_10294324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018989|Ga0193030_10304057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300019001|Ga0193034_10075273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300019001|Ga0193034_10088423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300019001|Ga0193034_10098964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300019001|Ga0193034_10117756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300019001|Ga0193034_10120177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300019001|Ga0193034_10136050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300019001|Ga0193034_10138405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019001|Ga0193034_10140351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300019001|Ga0193034_10145072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300019003|Ga0193033_10209542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300019010|Ga0193044_10277321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300019017|Ga0193569_10188281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium920Open in IMG/M
3300019017|Ga0193569_10241196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300019017|Ga0193569_10241215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300019017|Ga0193569_10307211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300019020|Ga0193538_10202448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300019022|Ga0192951_10173128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium776Open in IMG/M
3300019022|Ga0192951_10265057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300019024|Ga0193535_10173425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300019024|Ga0193535_10208934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300019025|Ga0193545_10079630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300019025|Ga0193545_10086769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300019025|Ga0193545_10087014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300019025|Ga0193545_10090166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019025|Ga0193545_10141835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300019025|Ga0193545_10144949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300019027|Ga0192909_10094248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium759Open in IMG/M
3300019027|Ga0192909_10106844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300019027|Ga0192909_10108227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300019031|Ga0193516_10189825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300019032|Ga0192869_10361365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300019032|Ga0192869_10465926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300019032|Ga0192869_10474814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300019036|Ga0192945_10202637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019036|Ga0192945_10291474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300019039|Ga0193123_10195495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium794Open in IMG/M
3300019039|Ga0193123_10370966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300019039|Ga0193123_10394807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300019045|Ga0193336_10265557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300019045|Ga0193336_10266605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300019045|Ga0193336_10312022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019045|Ga0193336_10324376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300019045|Ga0193336_10421021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300019045|Ga0193336_10450288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300019045|Ga0193336_10458604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300019045|Ga0193336_10565174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300019045|Ga0193336_10633353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300019045|Ga0193336_10691916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300019046|Ga0193546_10060102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019050|Ga0192966_10201018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300019050|Ga0192966_10223271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300019050|Ga0192966_10229448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300019051|Ga0192826_10121640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium948Open in IMG/M
3300019051|Ga0192826_10151012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium854Open in IMG/M
3300019051|Ga0192826_10151018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium854Open in IMG/M
3300019051|Ga0192826_10211046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300019051|Ga0192826_10217070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300019051|Ga0192826_10224373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300019051|Ga0192826_10235285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300019051|Ga0192826_10241070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300019051|Ga0192826_10245538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300019051|Ga0192826_10246429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300019051|Ga0192826_10256372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300019051|Ga0192826_10294704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300019051|Ga0192826_10317810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300019051|Ga0192826_10324451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019051|Ga0192826_10353210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300019051|Ga0192826_10381172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300019051|Ga0192826_10389864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300019095|Ga0188866_1013190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium841Open in IMG/M
3300019095|Ga0188866_1021910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300019095|Ga0188866_1028765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300019097|Ga0193153_1017658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300019097|Ga0193153_1021649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300019097|Ga0193153_1022706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300019097|Ga0193153_1023857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300019097|Ga0193153_1029632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300019099|Ga0193102_1014677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300019102|Ga0194243_1007468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300019102|Ga0194243_1007868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300019103|Ga0192946_1059934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300019116|Ga0193243_1042435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300019116|Ga0193243_1044372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300019116|Ga0193243_1050150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019116|Ga0193243_1064896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300019117|Ga0193054_1036901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300019117|Ga0193054_1039882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300019117|Ga0193054_1043844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300019117|Ga0193054_1044856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300019118|Ga0193157_1017298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300019118|Ga0193157_1018449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300019118|Ga0193157_1029531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300019118|Ga0193157_1035038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300019120|Ga0193256_1059793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300019123|Ga0192980_1060494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300019125|Ga0193104_1015076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium988Open in IMG/M
3300019125|Ga0193104_1018808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300019125|Ga0193104_1023633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum829Open in IMG/M
3300019125|Ga0193104_1034577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300019125|Ga0193104_1037125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300019125|Ga0193104_1054110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019125|Ga0193104_1056988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300019125|Ga0193104_1059694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019126|Ga0193144_1083761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019129|Ga0193436_1030630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300019129|Ga0193436_1056349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300019129|Ga0193436_1058738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300019131|Ga0193249_1100737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300019133|Ga0193089_1117658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300019139|Ga0193047_1086550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300019145|Ga0193288_1058795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300019149|Ga0188870_10060549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium923Open in IMG/M
3300019149|Ga0188870_10103966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300019149|Ga0188870_10112274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019150|Ga0194244_10017057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300019150|Ga0194244_10047231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019150|Ga0194244_10051207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300019150|Ga0194244_10069734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300019261|Ga0182097_1211300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300019272|Ga0182059_1153555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300019282|Ga0182075_1582355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019282|Ga0182075_1760256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300019283|Ga0182058_1678905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300020182|Ga0206129_10180271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium958Open in IMG/M
3300020396|Ga0211687_10325403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300021169|Ga0206687_1036663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300021169|Ga0206687_1447095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021305|Ga0210296_1034690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300021317|Ga0210309_1035136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300021334|Ga0206696_1221085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300021342|Ga0206691_1848809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium784Open in IMG/M
3300021348|Ga0206695_1384723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021350|Ga0206692_1171312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300021350|Ga0206692_1576142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300021350|Ga0206692_1628676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300021350|Ga0206692_1631195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021350|Ga0206692_1686728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021353|Ga0206693_1159328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300021353|Ga0206693_1449206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300021866|Ga0063109_103925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300021867|Ga0063130_103777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300021868|Ga0063111_104252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300021872|Ga0063132_102346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300021872|Ga0063132_113548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300021872|Ga0063132_116752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300021877|Ga0063123_1057822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300021880|Ga0063118_1003828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300021881|Ga0063117_1003733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300021881|Ga0063117_1008855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300021881|Ga0063117_1013704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300021881|Ga0063117_1018011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300021887|Ga0063105_1054219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300021889|Ga0063089_1072380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300021890|Ga0063090_1028557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300021892|Ga0063137_1020498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300021893|Ga0063142_1007860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021895|Ga0063120_1084905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021896|Ga0063136_1040438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300021898|Ga0063097_1074906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300021899|Ga0063144_1025779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300021899|Ga0063144_1040424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300021899|Ga0063144_1057997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300021908|Ga0063135_1011565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300021912|Ga0063133_1002017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300021912|Ga0063133_1004873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300021912|Ga0063133_1010001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300021912|Ga0063133_1013492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300021913|Ga0063104_1024098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300021924|Ga0063085_1009401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300021924|Ga0063085_1128759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300021927|Ga0063103_1087609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300021930|Ga0063145_1062809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300021934|Ga0063139_1007108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300021934|Ga0063139_1012624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300021935|Ga0063138_1005980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300021935|Ga0063138_1012714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300021950|Ga0063101_1059863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300022074|Ga0224906_1075899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1025Open in IMG/M
3300022074|Ga0224906_1223257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300022367|Ga0210312_110644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300023555|Ga0232120_106780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300023566|Ga0228679_1022475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300023674|Ga0228697_121492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300023683|Ga0228681_1036037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300023683|Ga0228681_1036433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300023695|Ga0228680_1026308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300023698|Ga0228682_1026514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium776Open in IMG/M
3300023698|Ga0228682_1036836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300023698|Ga0228682_1039904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300023698|Ga0228682_1041639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300023698|Ga0228682_1044365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300023699|Ga0228695_1060676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300023701|Ga0228685_1030526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300023704|Ga0228684_1052870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300023704|Ga0228684_1055840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300023704|Ga0228684_1059478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300023709|Ga0232122_1109509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300024334|Ga0228671_1108504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300025138|Ga0209634_1166772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium879Open in IMG/M
3300025138|Ga0209634_1252931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300025138|Ga0209634_1302317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300025626|Ga0209716_1068421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1098Open in IMG/M
3300025626|Ga0209716_1146892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300025680|Ga0209306_1067094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1116Open in IMG/M
3300025704|Ga0209602_1231592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300025849|Ga0209603_1240039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300025894|Ga0209335_10261007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium756Open in IMG/M
3300026403|Ga0247557_1031369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300026403|Ga0247557_1038375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300026420|Ga0247581_1047681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300026423|Ga0247580_1078114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300026443|Ga0247559_1097910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300026447|Ga0247607_1035431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium860Open in IMG/M
3300026447|Ga0247607_1037499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium837Open in IMG/M
3300026447|Ga0247607_1059298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300026447|Ga0247607_1076324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300026447|Ga0247607_1098519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300026448|Ga0247594_1073716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300026448|Ga0247594_1084798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300026448|Ga0247594_1103500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300026449|Ga0247593_1080205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300026449|Ga0247593_1088775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300026458|Ga0247578_1077869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300026458|Ga0247578_1082367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300026458|Ga0247578_1126987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300026461|Ga0247600_1088856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300026461|Ga0247600_1116408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300026462|Ga0247568_1044320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300026462|Ga0247568_1129380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300026465|Ga0247588_1072572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300026465|Ga0247588_1093969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300026465|Ga0247588_1122311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300026465|Ga0247588_1125574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300026468|Ga0247603_1097915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300026468|Ga0247603_1100588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300026468|Ga0247603_1135044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300026470|Ga0247599_1021079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1362Open in IMG/M
3300026470|Ga0247599_1100870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300026470|Ga0247599_1112534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300026470|Ga0247599_1119953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300026495|Ga0247571_1049982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium941Open in IMG/M
3300026495|Ga0247571_1086192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300026500|Ga0247592_1112703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300026503|Ga0247605_1087469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium765Open in IMG/M
3300026503|Ga0247605_1111163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300026504|Ga0247587_1059306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium940Open in IMG/M
3300026513|Ga0247590_1123199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300026513|Ga0247590_1176702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300026513|Ga0247590_1190537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300027687|Ga0209710_1124055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium977Open in IMG/M
3300027687|Ga0209710_1135115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium916Open in IMG/M
3300027687|Ga0209710_1150631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium845Open in IMG/M
3300027801|Ga0209091_10424112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300027833|Ga0209092_10281894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300028008|Ga0228674_1143067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium802Open in IMG/M
3300028095|Ga0247563_1102679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300028099|Ga0247576_1048196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium930Open in IMG/M
3300028102|Ga0247586_1062634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300028106|Ga0247596_1102224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300028106|Ga0247596_1112541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300028106|Ga0247596_1130505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300028106|Ga0247596_1135378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300028109|Ga0247582_1134093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300028110|Ga0247584_1177380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300028119|Ga0247561_121298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300028134|Ga0256411_1122728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium871Open in IMG/M
3300028137|Ga0256412_1180715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300028137|Ga0256412_1185431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300028137|Ga0256412_1242132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300028137|Ga0256412_1282174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300028137|Ga0256412_1315284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300028137|Ga0256412_1343268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300028194|Ga0257106_1304152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300028233|Ga0256417_1123962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300028233|Ga0256417_1157815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300028233|Ga0256417_1176605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300028233|Ga0256417_1185553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300028233|Ga0256417_1187436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300028282|Ga0256413_1138036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300028282|Ga0256413_1145727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium858Open in IMG/M
3300028282|Ga0256413_1279859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300028290|Ga0247572_1066663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium872Open in IMG/M
3300028290|Ga0247572_1120775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300028330|Ga0247601_1060457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300028333|Ga0247595_1085287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300028334|Ga0247597_1055633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300028575|Ga0304731_10045094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300028575|Ga0304731_10212491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300028575|Ga0304731_10246928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300028575|Ga0304731_10307365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300028575|Ga0304731_10935487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300028575|Ga0304731_10971993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300028575|Ga0304731_11156627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300028575|Ga0304731_11265109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300028672|Ga0257128_1079783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300030670|Ga0307401_10361522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300030670|Ga0307401_10454320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300030670|Ga0307401_10513528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300030671|Ga0307403_10532572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300030699|Ga0307398_10513481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300030715|Ga0308127_1042328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300030715|Ga0308127_1042795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300030721|Ga0308133_1038839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300030721|Ga0308133_1053020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300030723|Ga0308129_1026952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300030723|Ga0308129_1027246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300030724|Ga0308138_1057536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300030725|Ga0308128_1032335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300030725|Ga0308128_1036919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300030725|Ga0308128_1041226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300030749|Ga0073969_10007360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300030756|Ga0073968_11977045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium811Open in IMG/M
3300030780|Ga0073988_10004307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300030780|Ga0073988_10007033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300030780|Ga0073988_12359625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium778Open in IMG/M
3300030780|Ga0073988_12367663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300030787|Ga0073965_11791178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300030788|Ga0073964_11634621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300030856|Ga0073990_10003937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300030856|Ga0073990_10021454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300030856|Ga0073990_10023840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300030856|Ga0073990_11910908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300030856|Ga0073990_12002009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300030856|Ga0073990_12024147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300030856|Ga0073990_12039366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300030856|Ga0073990_12040157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300030856|Ga0073990_12059428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300030857|Ga0073981_10006268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300030857|Ga0073981_11662558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300030857|Ga0073981_11699091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300030857|Ga0073981_11704032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300030857|Ga0073981_11728878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300030869|Ga0151492_1050537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300030870|Ga0151493_135356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300030910|Ga0073956_10942099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030912|Ga0073987_11213948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300030912|Ga0073987_11217283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300030918|Ga0073985_10865574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300030952|Ga0073938_12164904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300030956|Ga0073944_11151077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300031004|Ga0073984_10006704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300031004|Ga0073984_11252519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300031004|Ga0073984_11260977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300031005|Ga0073974_1748620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300031032|Ga0073980_11354647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300031032|Ga0073980_11362986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300031032|Ga0073980_11386953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300031032|Ga0073980_11397073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300031037|Ga0073979_10004119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300031037|Ga0073979_10007465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300031037|Ga0073979_10012408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031037|Ga0073979_12298458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300031038|Ga0073986_10000230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300031038|Ga0073986_10001793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300031038|Ga0073986_10003668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300031038|Ga0073986_10005442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300031038|Ga0073986_12046135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300031062|Ga0073989_10000227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300031062|Ga0073989_10009098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300031062|Ga0073989_10009864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300031062|Ga0073989_10017156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300031062|Ga0073989_10022658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300031062|Ga0073989_13458572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300031062|Ga0073989_13500692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300031062|Ga0073989_13515525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300031062|Ga0073989_13530037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300031062|Ga0073989_13546354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300031062|Ga0073989_13578475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300031062|Ga0073989_13591047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300031062|Ga0073989_13610523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300031113|Ga0138347_10149103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300031121|Ga0138345_10084056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300031522|Ga0307388_10984450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300031540|Ga0308143_123516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300031540|Ga0308143_127218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300031550|Ga0307392_1063599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031557|Ga0308148_1017518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium807Open in IMG/M
3300031570|Ga0308144_1031263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300031570|Ga0308144_1035627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300031570|Ga0308144_1043392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300031621|Ga0302114_10279320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300031621|Ga0302114_10365071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300031622|Ga0302126_10316048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300031638|Ga0302125_10282102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031674|Ga0307393_1137003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300031717|Ga0307396_10357092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300031717|Ga0307396_10574287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300031725|Ga0307381_10254632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300031725|Ga0307381_10255800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300031729|Ga0307391_10556762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300031729|Ga0307391_10808298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300031734|Ga0307397_10418522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300031735|Ga0307394_10335232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300031738|Ga0307384_10432200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300031739|Ga0307383_10527668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300031742|Ga0307395_10435859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300031742|Ga0307395_10538886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300031743|Ga0307382_10256794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium782Open in IMG/M
3300031743|Ga0307382_10490695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300031750|Ga0307389_10742137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300031750|Ga0307389_10831987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300031750|Ga0307389_10942159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300032047|Ga0315330_10622339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300032047|Ga0315330_10691574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300032047|Ga0315330_10882624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300032470|Ga0314670_10434676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300032470|Ga0314670_10530875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300032481|Ga0314668_10471594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300032517|Ga0314688_10522670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300032521|Ga0314680_10659893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300032521|Ga0314680_10759202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300032540|Ga0314682_10463229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300032540|Ga0314682_10658904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300032615|Ga0314674_10532988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300032616|Ga0314671_10419771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300032616|Ga0314671_10470495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300032617|Ga0314683_10671108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300032617|Ga0314683_10674422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300032650|Ga0314673_10659674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300032651|Ga0314685_10504757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300032666|Ga0314678_10034044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1567Open in IMG/M
3300032666|Ga0314678_10433407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300032707|Ga0314687_10287957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium890Open in IMG/M
3300032714|Ga0314686_10488642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300032723|Ga0314703_10389300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300032724|Ga0314695_1316317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300032725|Ga0314702_1314689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300032726|Ga0314698_10566799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300032727|Ga0314693_10617537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300032730|Ga0314699_10223633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300032730|Ga0314699_10322557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300032742|Ga0314710_10344649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300032743|Ga0314707_10668004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300032746|Ga0314701_10484686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300032747|Ga0314712_10498164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300032752|Ga0314700_10327325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium810Open in IMG/M
3300033572|Ga0307390_10624053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300033572|Ga0307390_10624587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300033572|Ga0307390_10914139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine44.16%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.79%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.95%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.28%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.07%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.70%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.46%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.34%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.85%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.85%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.24%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.12%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.12%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.12%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.12%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.36%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.36%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.36%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.36%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003303Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006362Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300008833Eukaryotic communities of water from the North Atlantic ocean - ACM7EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009728Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009730Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011312Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018502Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001750 (ERX1782144-ERR1711886)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018556Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001478 (ERX1789635-ERR1719475)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018761Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018805Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002019 (ERX1789361-ERR1719395)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018821Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789489-ERR1719145)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018828Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002925 (ERX1789466-ERR1719252)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019046Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408503-ERR1336911)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019145Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001610 (ERX1809765-ERR1740132)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021867Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S3 C1 B8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021868Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021877Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021880Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021895Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023699Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028095Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028099Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 33R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030869Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030870Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S8_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030910Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0006246J48908_103792513300003303SeawaterRTMKFAIAALLGLAAASQKIKESDPSPAYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERAKEYTDTTTGLKTGGEPTGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0008458J53046_10155913300003677SeawaterRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0066830_1011800013300005433MarineMKFAIACLLGLVAAKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLSGQLLDDYITTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSD
Ga0066840_1013782913300005608MarineMKFAIAALLGLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLNTHKGLSGGALDAYITTYFGKAWGHFDVNQ
Ga0078893_1068354323300005837Marine Surface WaterALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNRTGYXXMPQFMRFLCSDQYMSLGESG*
Ga0075502_100778913300006357AqueousRTNMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075508_14903613300006362AqueousPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075513_132267013300006379AqueousNMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075516_138030413300006384AqueousTNMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075507_151679413300006392AqueousMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075495_144510813300006399AqueousNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075506_100175213300006401AqueousHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0031676_140405513300006728Deep OceanYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYANTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0031676_143138013300006728Deep OceanMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLAGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0105744_104045823300007863Estuary WaterMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0105744_106996313300007863Estuary WaterVAVKESDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0105743_104306423300007958Estuary WaterMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQT
Ga0103881_10038623300008833Surface Ocean WaterPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGEVDVIKSPQFMRFLASDQYMSLQ*
Ga0103732_101538323300008929Ice Edge, Mcmurdo Sound, AntarcticaMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0103739_100955123300008936Ice Edge, Mcmurdo Sound, AntarcticaMKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103739_106279713300008936Ice Edge, Mcmurdo Sound, AntarcticaMKFAIAALLGVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP*
Ga0104261_103856413300008956Ocean WaterAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEFIMMLQFMRFLCSDQDMSLGESG*
Ga0104259_102062223300008958Ocean WaterVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0104259_102078413300008958Ocean WaterSIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGAALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0104259_103309313300008958Ocean WaterIAALLGLAAASQKIKESDPSPAYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERAKEYTDTTTGLKTGGEPTGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0104259_103863613300008958Ocean WaterIAALLGFVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP*
Ga0104258_101578613300008993Ocean WaterKITMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0104258_108017113300008993Ocean WaterNKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP*
Ga0104258_111388213300008993Ocean WaterMKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGAALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0103502_1023263613300008998MarineMKFAVAALIGLVGAAKLDKDYDPVPKYFTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103502_1024247913300008998MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0103502_1041493213300008998MarineMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0103710_1009284213300009006Ocean WaterFVNFASKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103706_1011878213300009022Ocean WaterMKFAVAALLGLVAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0103707_1003681913300009025Ocean WaterDIPIPMDQQTNIILSDATAAEAQVGGFVNFASKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNSAAALAAAKEVLQTHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103708_10013378913300009028Ocean WaterTNMKFAVAALIGLAGAATLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115566_1023119223300009071Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0114995_1015128423300009172MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0114995_1022915813300009172MarineMKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0114995_1030587813300009172MarineMKFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP*
Ga0103872_101193713300009263Surface Ocean WaterRAAQAKLCRSVQKKVDQPLLKKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0103872_102488913300009263Surface Ocean WaterDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLATHKGLTGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0103873_101160013300009265Surface Ocean WaterMKMSEGKRDAKIRKAEKKIKELDPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLATHKGLTGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0103873_109777613300009265Surface Ocean WaterLLGLAAAHQGIKEIDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0103878_102647913300009274Surface Ocean WaterQLNKEYDATPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERNKVIEHDDGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGDFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0103879_1001623213300009276Surface Ocean WaterKFIVAAFLGLAAAVKIDKESDPVPKYYTPFDHEATYYGRVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0114998_1015172123300009422MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0114998_1021291213300009422MarineMKFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP*
Ga0115562_125476023300009434Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115008_1029321013300009436MarineMKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0115008_1046162113300009436MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP*
Ga0115571_113202513300009495Pelagic MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115572_1031725113300009507Pelagic MarineMKFAIAALLGFFAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0115567_1025402223300009508Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115004_1096311913300009526MarineMKFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSG
Ga0115099_1007579213300009543MarineTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHDATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115099_1078865513300009543MarineMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTYDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG*
Ga0115101_117524613300009592MarineRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115101_142653513300009592MarineMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG*
Ga0115011_1172702713300009593MarineMKFAYIALLGTVAAAPKELDPSPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDDGLKTGGEPNGKFWMNQASTLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFL
Ga0115103_115859413300009599MarineNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115103_154106213300009599MarineMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG*
Ga0115102_1001347813300009606MarineKFAIAALLGFVAVQAINVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGAALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0115100_1022849613300009608MarineMKFAIAALLGLAAASQKIKESDPSPAYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERAKEYTDTTTGLKTGGEPTGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0115100_1065011713300009608MarineMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115104_1000638713300009677MarinePKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115104_1003848113300009677MarineMKFAIAALLGLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTSTGLKTGGEPSGKFWMNKASTFAAAKEVIGTHKGLTGKMADDYLNTYFDKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0115104_1004153513300009677MarineMKFAVLAFLGVVAAKDYDASPKYYTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG*
Ga0115104_1101891413300009677MarineRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0115104_1111335913300009677MarineKFAVALFLGVAAAVKIEKDYDASPKFFTPFDHDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLSSDQYMSLGESGCT*
Ga0115105_1084935013300009679MarineMKFAYIALLGLVAAKEVDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIETYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLGTHKGLAGKLLDDYVNTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0115105_1092449113300009679MarineMKFAYIALLSVVAAKDKEVDPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIETYALEERNKVIEHDNGLKSGGEPNGKFWMNKSGTLAAAKEVLGTHKGLSGKLLDDYVNTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0115105_1093696413300009679MarineVLIGVVAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQSAALAASKEVLGTHKGLAGKLLDDYMNTYFAKTWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG*
Ga0115105_1108848913300009679MarineTMKFAVLAFLGVVAAKDYDASPKYFTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLATHKGLTGGLLDDYMKTYFTKAWGHFDVNQTGFIEVIKMP*
Ga0115000_1038466413300009705MarineMKFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP*
Ga0123371_17482113300009728MarineFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0123359_18333013300009730MarineKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0123373_18623613300009732MarineMKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0123377_101385113300009735MarineEKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0123379_102953913300009738MarineIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0123361_105937613300009741MarineTNMKFAVAALIGLASAATLNKEYDASPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLTGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115001_1097087823300009785MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKAWGHFDVNQT
Ga0138316_1007582313300010981MarineKFAVAAFIGLAAAVKMDKESDPSPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIKKYAVEERTDTEELDDGTKIGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0138316_1011243613300010981MarineMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138316_1047563013300010981MarineRTTMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLTGQLLEDYMSTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138316_1075485413300010981MarineMKFAVAAFLSLAAAVQIDKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNEASAASAAREVLGTHKGLSGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138316_1084942123300010981MarineMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138316_1088197513300010981MarineFAIACLLGLVASKTYDASPKYYTPFDHEATYYERITTPRFSADTDDIFMRSMIEQYALEERTKITEHDDGLKSGGEPSGKFWMNQSSTMAAAREVLATHKGLTGQLLDDYMSTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0138316_1088310913300010981MarineNMKFAVAAFIGLVAAVKVDKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLATHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138316_1107895313300010981MarineYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNPVDNLANGLTTGGEPSGKFWMNESTALAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMQLGESG*
Ga0138316_1130756213300010981MarineVAAFIGLAAAITVDKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERAKEYKDTDTGLKTGGEPTGKFWMNHAATLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0138326_1030297713300010985MarineSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLATHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138326_1088929313300010985MarineNMKFAVAAFIGLAAAITVDKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERAKEYKDTDTGLKTGGEPTGKFWMNHAATLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0138326_1107388713300010985MarineYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAALAASKEVLGTHKGLSGKLLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138326_1139139413300010985MarineFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNEASAASAAREVLGTHKGLSGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138326_1191516913300010985MarineTMKFVYAALLSVAAAKLSTPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNPVDNLANGLTTGGEPSGKFWMNESTALAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMQLGESG*
Ga0138324_1013853133300010987MarineMKFAVALFLGVAAAVKVQKDYDASPKYFTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTSTGLKTGGEPSGKFWMNKASTFAAAKEVIGTHKGLTGKMADDYLNTYFDKSWGHFDVNQTGFVEVIKMPQLMRFLCSFFHHERGCAIFKHKGFILIRPIGRVGLHL
Ga0138324_1041218113300010987MarineKFIVAAFIGLASAKSYDASPKYYTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTQVNEADDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGALLDNYMDTYFTKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0138324_1042891613300010987MarineTMKFAIACLLGLVASKTYDASPKYYTPFDHEATYYERITTPRFSADTDDIFMRSMIEQYALEERTKITEHDDGLKSGGEPSGKFWMNQSSTMAAAREVLATHKGLTGQLLDDYMSTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0138324_1044862713300010987MarineNMKFAVALFLGVAAAVNVQKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAALAASKEVLGTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138324_1045128313300010987MarineRVTTPRFSTDGDDIFMRSMIEQYAAKELDPSPAYYSPFDNEATYYERVTTPRFSTDGDDIFMRSMIEQYALEERNKITLHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLAGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0138324_1051417313300010987MarineNMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138324_1052065113300010987MarineMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLTGQLLEDYMSTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138324_1053106913300010987MarineRTTMKFAVLAFLGVVAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLATHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138324_1060996913300010987MarineTMKFAAIAAFLGAAAASQKIKELDPSPEYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERAKEYKDTDTGLKTGGEPTGKFWMNHAATLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0138324_1070274113300010987MarineMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTQVTDHDDGTSSGGEPSGKFWMNQSAANAAAREVLTTHKGLTGSLLEDYMSTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138324_1070543113300010987MarineRTNMKFAVAAFIGLAAAVKVDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVNEADDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138324_1072217313300010987MarineNMKFAVAAFIGLAAAVQIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVNEADDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG*
Ga0138349_109466013300011312Deep OceanNMKFAVAALIGLAGAATLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0123369_101817713300012370MarineLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYADTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0123365_132216013300012394MarineRMPAHFASDDDDIFMRSMIENYALEERTKVNEADDGTKSGGEPSGKFWMNQASALAAAKEVLGTHKGLSGKLLDDYITTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0129347_118642713300012504AqueousERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129349_103619213300012518AqueousMKFAAAALIGFVGAAELAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129349_115652913300012518AqueousMKFAVAAFLGLAAAVQIEKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129349_115741913300012518AqueousMKFAVAAFLGLAAAVQIEKEYDASPKYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129349_127482713300012518AqueousMKFAVAALIGAVAAVQVDKDYFTVFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129349_133832313300012518AqueousMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129344_104568213300012520AqueousEATYSERVTTPRFAEDSDDLLMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129350_115514513300012523AqueousMKFIVAALIGAVAAVQVDKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG*
Ga0129350_119505113300012523AqueousMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129350_121771313300012523AqueousMKFAVAAFIGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129350_128620413300012523AqueousRTNMKFAVAAFLGLAAAVQIEKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129350_134570913300012523AqueousKMKFVIAALIGLAASVKIDKDYFTVFDHESTYYERVTTPRFSADTDDIFMRSMIENYALEEKTKVVEHDDGTKSGGEPSGHFWMNEALALAASKEVLATHKGLSGKMLDDYLNTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG*
Ga0129350_135920713300012523AqueousNMKFAVAALLGLASAVKIEKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIENYALEERTKVNEADDGTKSGGEPSGKFWMNQASALAAAKEVLGTHKGLSGKLLDDYITTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG*
Ga0129353_167048313300012525AqueousKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKDVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG*
Ga0129353_167242813300012525AqueousMKFAAAALIGFVGAAELAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129353_191438413300012525AqueousFAVAAFLVLAAAVQIEKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129352_1049069113300012528AqueousMKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAREVLGTHKGLSCKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129352_1063434213300012528AqueousNMKFAAAALIGFVGAAELAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129352_1072946713300012528AqueousTNMKFIVAALIGAVAAVQVDKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129352_1099451113300012528AqueousTNMKFAVAAFLGLAAAVQIEKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0160423_1048383413300012920Surface SeawaterLAAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0163111_1044974813300012954Surface SeawaterMKFAVLALLGVVSAIEKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAASKEVLATHKGLSGKLLDDYVTTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0182057_130194113300016732Salt MarshRTMKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0182047_104672513300016737Salt MarshDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0182096_129162913300016740Salt MarshNMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0182062_127719313300016751Salt MarshHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESC
Ga0181390_109850213300017719SeawaterMKFAIAALLGLVAVQAVSVSEVDYYTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFICSDQYMSLGESG
Ga0181390_110176613300017719SeawaterHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWKHFDVNQSGTIEVLKMP
Ga0181390_117431713300017719SeawaterMKFVIAALIGLAATVKVDKDYFTVFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0181388_106368323300017724SeawaterMKFIVAAFLGLATAVQLENQDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0181416_106887713300017731SeawaterMKFAVLALVGLAAAVKVEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGQELAAYVQTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0181427_110373513300017745SeawaterDTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0181393_104372813300017748SeawaterMKFAVLALVGLAAAVKVEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0181392_107584513300017749SeawaterMKFAVLALIGAVAAVQKDASPKYFTPFDHAATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVSDNADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFAKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0187219_114098713300017751SeawaterMKFAIAALLGLVAVQAVSVSEVDYYTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFICSDQYMSLGESGXAXIKHNLVSQIXRLLKLIRNKEMENKVLYYELFKQY
Ga0187219_114343513300017751SeawaterMKFVIAALIGLAATVKVDKDYFTVFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0181382_105064313300017756SeawaterMKFIVAALVGIAASVEVKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0181430_117416513300017772SeawaterMKFAIAALLGLVAVQAVIVGDYFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWKHFDVNQSGTIEVLKMP
Ga0181394_124680523300017776SeawaterMKFAVLALVGLAAAVKVEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVN
Ga0181395_105904313300017779SeawaterMKFAVLALVGLAAAVKVEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGQELAAYVQTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0181379_111065913300017783SeawaterMKFAVAAFLGLAAAVSIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVN
Ga0181567_1068458413300018418Salt MarshMKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193334_10372713300018502MarineYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192960_10405413300018515MarineMKFAIAALIGLAGAAQVEKEIDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVIEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192942_10456513300018556MarineNMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0192942_10500313300018556MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVIEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0188858_10553313300018567Freshwater LakeMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193474_101399713300018575MarineAVKVEKDYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193060_101592313300018596MarineAVKVQKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193060_102055013300018596MarineTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193060_102174813300018596MarineEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193182_100741313300018602MarineMKFAVAALIGLAGAAQLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193204_100881913300018618MarineGGFVNLSMKDYDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193204_101180113300018618MarineERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0192842_101203413300018625MarineHGGTLKFDIPIPMDQANIIVSDAVAAEAQVGGFVNLSMKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEKYALEERTKVIGHTSDGRKIGGEPTGRFWLNKDAVRAESKKVLEKHKGLSGKELDQYMDTYFDKAWGHFDVNVTGVIEVIKMPQFQRFLASDQYMSLGES
Ga0192842_101214213300018625MarineHGGTLKFDIPIPMDQANIIVSDAVAAEAQVGGFVNLSMKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192842_102217313300018625MarineIFMRSMIEQYALEERTKVTLHDDGTKSGGEPSGKFFMDQKAAKAAARQVLHTHKGLSGKHLDIYIDTHFAKAWGHFDVNRTGVIAVVKMPQFMRFLSSDQYMSLKLGAGGRRESA
Ga0192842_103330213300018625MarineTYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAREVLGTHKGLSGKMLDDYMETYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193355_100911223300018628MarineMKFAVAAMVGLVAAVKKEVDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHDDGTKSGGEPSGKFWMNQAAAVAASKEVLGTHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193355_101333813300018628MarineDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193355_101430813300018628MarineMKFAVAAMVGLVAAVKKEVDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193355_101756913300018628MarineMKFVVAIFLGLAAAVKVEKDYDASPKFFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193355_102206513300018628MarineERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192969_103718913300018649MarineMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192969_104296913300018649MarineFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192906_103326413300018658MarineKFAVAALIGLAGAATLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVATYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0192906_104083013300018658MarineKFAVAALIGLAGAATLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193122_105196813300018661MarinePFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193571_101194413300018671MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193166_101937513300018674MarineEVKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVVEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193166_102217613300018674MarinePFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193166_102387013300018674MarineHGEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192944_102242713300018692MarineMKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192944_103634713300018692MarineMKFVVAIFLGFAAAVKVEKDYDASPKFFTTADKDAQYYERQTTPRFSSDSDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKSWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192944_103758013300018692MarineMKFAIAALIGLAGAAQVEKEIDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVIEHGDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192944_103936313300018692MarineTWGTNMKFAVALFLGVAAAVKVQKDYDASPKFYTPFDHDGTYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192944_104472113300018692MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0193195_103949313300018699MarineHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLQTHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193405_102458713300018701MarineMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193405_103169613300018701MarineNMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193405_103305313300018701MarineMKFVLAAFLGLAAAVKIDKDYDASPKYFSTADKDAHYYERVTTPRFSADSDDIFMRSMIEQYALEERTQIHEADDGLKTGGEPSGKFWMNEATTRAAAREVLQTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193324_103535913300018716MarineLLGFASVSAIQKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLNNYMDTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193391_103610913300018724MarineRTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192967_105779513300018730MarineMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0192967_105779613300018730MarineMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNTATAKAASSEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192967_105889413300018730MarineMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0193544_102023313300018735MarineRTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193544_102340613300018735MarineGNMKFAVAALIGLVGAAELAKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQSSAGLAAREVLATHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193534_104547113300018741MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193138_103058713300018742MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193138_103109313300018742MarineMKFAVLALIGAVAAVQKDASPKYYTPFDHEATYYERVVTPRFSADSDDIFMRSMIEQYALEERNSVTENADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFAKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193138_103118913300018742MarineNMKFAVAALIGMVGAIQKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKSGGEPSGKFWMNEAATRAAAREVLTTHKGLTGKLLDDYMETYFGKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193138_103175113300018742MarineMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193138_103213713300018742MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193138_103686213300018742MarineINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193138_105161413300018742MarineDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193138_105229113300018742MarineMKFVVAIFLGFAAAVKVEKDYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193000_102383513300018745MarineWERTNMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193000_103233113300018745MarineYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQAAANAAAKEVLTTHKGLTGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193000_103355313300018745MarineTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193000_103551213300018745MarineTDDIFMRSMIEQYALEERNKITEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193000_106310113300018745MarineAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193468_104557013300018746MarineMKFAVALFLGVAAAVKVQKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193468_105169213300018746MarineKFVVAIFLGLAAAVKVEKDYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193468_106370713300018746MarineTNMKFAVAAMVGLVAAVKKEVDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHDDGTKSGGEPSGKFWMNQAAAVAASKEVLGTHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLVSPAEHEKLRKKYKIK
Ga0193392_103560213300018749MarineNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193063_107087113300018761MarinePFDNEATYYERVTTPRFSTDGDDIFMRSMIEQYALEERNKITLHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192963_105643813300018762MarineTMKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192963_106216913300018762MarineKMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNTATAKAASSEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192963_106217013300018762MarineKMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0192963_106218313300018762MarineKMNFAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192827_103648813300018763MarineMDQQANIIVSDAVAAEAQVGRVNFAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192827_105395713300018763MarineMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192827_105526013300018763MarineMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLQTHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192827_107024613300018763MarineSDPVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192827_107770013300018763MarineDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMDTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192827_107802313300018763MarineEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAREVLGTHKGLSGKMLDDYMETYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192827_109023113300018763MarineADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLSGQLLEDYMTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192827_109048213300018763MarineADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLSGQLLEDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192827_109231713300018763MarineKVEKEYDASPKYFTTADKDAHYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHEDDAGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193031_104847813300018765MarineMKFAVALFLGVAAAVKIEKDYDASPKFFTPFDHDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLVEVIKMPQLMRFLSSDQYMSLGESG
Ga0193031_104879513300018765MarineMKFAVAALIGLAAAIKGESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193031_105107013300018765MarineMKFAVAALIGAVVAKSYDASPKYFTPFDHEATYYERVTPARFATDGDDIFMRSMIEQYALEERTKINEADDGLKSGGEPSGKFWMNEAATRAAAREVLGTHKGLSGKLLDDYMETYFGKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193031_105155413300018765MarineMKFAVIALIGAVSAVQKEYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIETYALEEKTKVEEDKVTGLKTGGEPTGKFWMNSAAATAAAKEVLTTHKGLTGDLLSNYMDTYYAKAWGHFDVNQTGYIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193031_105548613300018765MarineMKFIVAAFLGLAAAVQVENKDYFTVFDDGNTVYSRATTARFSADTDDIFMRSMIQQYALEEKTPVEKLANGLSIGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKSWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0193031_106086113300018765MarineMKFVLAAFLGLAAAVKIDKDYDASPKYFSTADKDAKYYERVTTPRFSADSDDIFMRSMIEQYALEERTQIHEADDGLKSGGEPSGKFWMNEATTRAAAREVLTTHKGLTGKLLDDYMTTYFAKSWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193031_106676813300018765MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193031_107289613300018765MarineMKFAVIALIGAVSAVQKEYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVEEDKVTGLKTGGEPTGKFWMNQSAARAAALEVLGTHKGLSGDLLSNYMDTYFTKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193031_107636013300018765MarineEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193031_108827113300018765MarineTDDIFMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193031_109463313300018765MarineTPRFAEDTDDIFMRSMIENYALEERSKVYEHDDGLKTGGDPTGKFWMNHSTTLAAAKEVLATHKGLTGKLLDDYVNTYFEKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193181_104190113300018766MarineMKFAVAALIGLAGAAQLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLSGQLLDDYITTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193181_104784013300018766MarineVKVEKEYDASPKYFTPFDHEATYYERTTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAREVLGTHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193181_105358713300018766MarineMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMDTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193530_107688113300018770MarineNMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193314_106390313300018771MarineLIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193407_103991613300018776MarineMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193149_104126513300018779MarineVVAIFLGFAAAVKVEKDYDASPKFFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193149_105190013300018779MarineKFAVALFLGVAAAVKVQKDYDASPKFFTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192832_104410213300018782MarineAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192832_105377613300018782MarineRVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGES
Ga0192832_105806613300018782MarineRVTPARFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAGAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGES
Ga0193124_103769513300018787MarineMKFAIAFLLGLVAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193124_104566813300018787MarineRTNMKFAVLALIGAVAAVQKDASPKYYTPFDHEATYYERVVTPRFSADSDDIFMRSMIEQYALEERNSVTENADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFSKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193124_105940613300018787MarineDYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNQASSLAAAKEVLATHKGMSGKILDDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193124_106725913300018787MarineYERVTTPRFSADTDDIFMRSMIENYALEERTKVNEADDGTKSGGEPSGKFWMNQASALAAAKEVLGTHKGLAGKLLDDYITTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192950_104156613300018791MarineMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKSWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192950_107377313300018791MarineTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193117_105866213300018796MarineKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193306_103023813300018800MarineRTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193306_105126513300018800MarineKFAVAAFIGLAAGAKIDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0193306_105808713300018800MarineTTMKFIVAAFLGLAAAKSYDASPKYFTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERNQINEAADGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGQLLDNYMDTYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192824_107680713300018801MarineKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192824_107918113300018801MarineKFAVLALIGAVAAVQKDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTTSGGEPSGKFWMNQSATLAAAKEVLGTHKGLSGKELDAYINTYFAKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0193409_105763613300018805MarineFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193409_106296613300018805MarineRTNMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192829_107207913300018812MarineKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192829_107242713300018812MarineRTNMKFAVAALIGLAGAAQLNKDYDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLQTHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193412_106011913300018821MarineTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_104918113300018823MarineMKFAVLALLGVVSAIEKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193053_104946013300018823MarineMKFAIAALLGLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIETYALEERNKEYKDTDTGLKTGGEPSGKFWMNHASTFAAAKEVLGTHKGLSGKMLDDYLNTYFEKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193053_104983913300018823MarineMKFAVLALLGVVSAIEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_105036313300018823MarineRTNMKFAVAALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_105050913300018823MarineTNMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_105240013300018823MarineRTNMKFAVAALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_105422513300018823MarineTNMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDDGLKTGGEPSGKFWMNKSSTTAAAREVLGTHKGLSGQLLDDYMTTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193053_105517013300018823MarineGLVAAKEIDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKITEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193053_106427313300018823MarineTVFDHDSTYYERVTTPRFSADSDDIFMRSMIEQYALEEKTKVVKLDNGLTTGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193490_108109613300018828MarineMKFAVAALIGLASAAQLNKEYDATPKYYTPFDHEATYYERVTPARFSADTDDIFMISMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193191_105211213300018830MarineRTNMKFAVAALIGLAGAAQLNKDYDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMDTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193191_105395313300018830MarineNMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192949_107501913300018831MarineMKFAVALFLGVASAIKVQKDYDASPKFFTTFDHDATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192949_108435613300018831MarineKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192949_108940213300018831MarineFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0194240_101124613300018832MarineQQANIIVSDAVAAEAQVGRVNFAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194240_101330213300018832MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDDGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLSGQLLDDYITTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0194240_101599213300018832MarineMKFAVAALIGLVGAAELSKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193302_105604013300018838MarineKFAYIALLAVVAAKDKEVDPSPAYYTPFDHEATYYERVTTPRFSEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193302_105607113300018838MarineKFAIAAFLGLAAGKITESTPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193302_105823513300018838MarineTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193302_105867813300018838MarineNMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193302_106385213300018838MarineKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0193302_106614213300018838MarineAALVGIAASVEVKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKLPNGLTTGGEPSGKFWMNEAAALAASKEVLNTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193302_108723413300018838MarineMKFVIAALIGLAATVKVDDYFTVFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVEHDNGLKTGGEPSGKFWMNEAAALAASKEVLATHKGLGGKLLDDYITTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193219_104515113300018842MarineMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193219_104688613300018842MarineTTMKFAVLALLGVVSAASRDASPKYYTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTQVTDHADGTSSGGEPSGKFWMNQSAANAAAREVLATHKGLTGQLLEDYMSTYFAKAWGHFDVNQTGYIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193219_104758513300018842MarineMKFAYIALLGLVAAKEIDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVIEHDDGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193219_107770813300018842MarineIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193312_106725213300018844MarineDTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLTGQLLDDYVTTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193253_105852413300018846MarineMKFAVAAFIGLAAGAKIDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0193253_106029823300018846MarineMKFAVAAFIGLAAGAKIDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193253_108698013300018846MarineSADTDDIFMRSMIEQYALEERNKKYTDSSTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193005_107461313300018849MarineAEDTDDIFMRSMIEQYALEERNKITEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193475_108413613300018855MarineDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193199_110307113300018859MarineGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193192_102865413300018860MarineYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTLHDDGTKSGGEPSGKFWMNQAAATAASKEVLATHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193192_102876813300018860MarineFTVQDHESHYYERKTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTTTGGEPTGKFWMDKFSALGAAREVLNTHKGLSGAALKAYLDTYFDKAWGHFDVNQTGTIEVIKMPGLMRFLCSDQYTQLGESG
Ga0193192_103910813300018860MarineYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193072_106395113300018861MarineRTNMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193072_109364613300018861MarineKFAYIALLGLVAAKEVDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193308_105195313300018862MarineRTTMKFAIACLLGLVAAKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLTGQLLDDYVTTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193308_105235613300018862MarineMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193308_106547213300018862MarineMKFVVAIFLGLAAAVKVEKDYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKTGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193308_106631813300018862MarineASPKFFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKIHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193421_108016713300018864MarineKFAVAALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193421_109765913300018864MarineDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193533_109519913300018870MarineFAVAALIGLAAAIKGESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193337_103437413300018880MarineMGIDKEYDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNEASAAAAAREVLNTHKGMSGKILDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192908_1002567813300018881MarineDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVVEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLATHKGLSGKMLEDYVATYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193471_107579113300018882MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193471_108451813300018882MarineFAVAAMVGLVAAVKKEVDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHDDGTKSGGEPSGKFWMNQAAAVAASKEVLGTHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193311_1006409913300018885MarineRTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWINQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193258_119145213300018893MarineAFIGLAAGAKIDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0193028_104340413300018905MarineTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193028_104916413300018905MarineLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193420_1010233813300018922MarineADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192989_1011139913300018926MarineFTMKFAIAALLGLVAVQAVSVSEVDYYTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFICSDQYMSLGESG
Ga0192989_1011283013300018926MarineMKFAIAAFIGLVSAHQGIKESTPSPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKKYTDSSTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0192989_1011441613300018926MarineMKFAIAAFIGLVSAHQGIKESTPSPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0192989_1015871713300018926MarineEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192989_1017284613300018926MarineDTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0193260_1009020813300018928MarineRTNMKFAVLALVGLAAAVKVEKEVDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKVNEHDDGTKTGGEPSGKFWMNQAATLAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193260_1009357313300018928MarineTMKFAVLAFLGVVAAKDYDASPKYYTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193260_1009889813300018928MarineRTNMKFIVAAFLGLATAVQLENKDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0193260_1010710213300018928MarineNMKFVVAIFLGLAAAVKVEKDYDASPKFFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEAVTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192955_1011114913300018930MarineYQQSTWGTNMKFAIAALIGLAGAAQVEKEIDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVIEHGDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYISLGESG
Ga0192820_1017810013300018932MarineEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193426_1008602413300018942MarineMKFAVAALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193426_1008608913300018942MarineMKFAVAALIGLVGAAQLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192985_119629513300018948MarineKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193379_1015855513300018955MarineAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193531_1024143713300018961MarineTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193087_1023518613300018964MarineNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193178_1004041513300018967MarineESPPHMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193178_1004131813300018967MarineESPPHMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGIKSGGEPSGKFWMNQAAALAASKEVLATHKGLSGKLLDDYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193178_1005633513300018967MarineVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDDGLKTGGEPSGKFWMNKSSTTAAAREVLGTHKGLSGQLLDDYMATYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193178_1007208213300018967MarineKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFSKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193178_1007466613300018967MarineRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGLTTGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193178_1007569013300018967MarineFSADTDDIFMRSMIEQYALEERTQVTEHDDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMDTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192894_1031694813300018968MarineYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAREVLTTHKGLTGKLLDDYMETYFGKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193143_1022301913300018969MarineFSADSDDIFMRSMIEQYALEERNSVTENADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFSKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG
Ga0192873_1029286213300018974MarineMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193353_1019763013300018977MarineTPFDHEATYYERVTTPRFSADTDDIFMRSMIETYALEERNKVIEHDNGLKSGGEPNGKFWMNKSGTLAAAKEVLGTHKGLSGKLLDDYVNTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193353_1022351313300018977MarineQTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAANAAAKEVLTTHKGLTGDLLANYMDTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193540_1005752313300018979MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193540_1007396013300018979MarineASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193540_1018689613300018979MarineDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192961_1017079713300018980MarineTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEYDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192968_1013517113300018981MarineMNFAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNTATAKAASSEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192968_1013517213300018981MarineMNFAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0192947_1012637513300018982MarineMKFAVLALIGVVSAVQKDASPKYFTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHADGTSSGGEPSGKFWMNQAASLAAAKEVLGTHKGLSGKELAAYIDTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192947_1016943313300018982MarineMKFAVALFLGVAAAVKVQKDYDASPKFYTPFDHDGTYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192947_1017718013300018982MarineMKFAIVALLGLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFEQDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQFMRFFCSDQYMSLGESG
Ga0193554_1033946113300018986MarineSAVKVDKDPVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1016763013300018989MarineMKFAVIALIGAVSAVQKEYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVEEDKVTGLKTGGEPTGKFWMNQSAARAAALEVLGTHKGLSGDLLSNYMDTYFTKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193030_1017353013300018989MarineMKFAVLALIAGAAALKVDKDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0193030_1017848813300018989MarineMKFAVAALIGMVGAIQKSYDASPKYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTSTGLKTGGEPSGKFWMNKASTFAAAKEVIGTHKGLTGKMADDYLNTYFDKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193030_1018179013300018989MarineMKFAVAALIGAVVAKSYDASPKYFTPFDHEATYYERVTPARFATDGDDIFMRSMIEQYALEERTKINEADDGLKSGGEPSGKFWMNEAATRAAAREVLTTHKGLTGKLLDDYMETYFGKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193030_1018179613300018989MarineMKFAVAALIGAVVAKSYDASPKYFTPFDHEATYYERVTPARFATDGDDIFMRSMIEQYALEERTKINEADDGLKSGGEPSGKFWMNEAATRAAAKEVLGTHKGLAGKLLDDYMETYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193030_1018235113300018989MarineMKFAYIALLGLAAAKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193030_1018258213300018989MarineMKFSYFALLAVVAAKPKESDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIENYALEERSKVIEHDDGLKTGGDPTGKFWMNHSSTLAAAKEVLATHKGLTGKLLDDYVNTYFEKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193030_1020186013300018989MarineMKFAVALFLGVAAAVKIEKDYDASPKFFTPFDHDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTSAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193030_1021515813300018989MarineTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193030_1022230713300018989MarineMKFAYIALLGLAAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVILHDNGLKTGGEPNGKFWMNQSTTLAAAKEVLATHKGLTGKLLDDYINTYFAKAWGHFDVNQSGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193030_1022946213300018989MarineWGTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1023020013300018989MarineMKFVIAALIGATAAIQNKDYFTTFDEGNPGGYARATTARFSADTDDIFMRSMIQQYALEEKTPVEKLANGLSIGGEPSGKFWMNEAAALAAAKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193030_1025282813300018989MarineTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEADDGLKTGGEPSGKFWMNEAGAHAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1025374013300018989MarineTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHADGTSSGGEPSGKFWMNQAASLAAAKEVLGTHKGLSGKELAAYIDTYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0193030_1026840813300018989MarineFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQAAALAAAKEVLTTHKGLTGKLLDDYVNTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1028816213300018989MarinePRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGSELSAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1029432413300018989MarineSADTDDIFMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193030_1030405713300018989MarineTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193034_1007527313300019001MarineMKFIVAALLGLAATVKVDDYFTVFDHDSTFYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHPDGLTSGGEPSGKFWMNESAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193034_1008842313300019001MarineMKFVVAIFLGFAAAVKVEKDYDASPKFFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193034_1009896413300019001MarineAASVQVDKDYFTVFDHESTYYERAITPRFSADTDDIFMRSMIENYALEEKTKVVKHDNGLTSGGEPSGKFWMNEAAALAAAKEVLTTHKGLTGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193034_1011775613300019001MarineMKFIVAALLGLAATVKVDDYFTVFDHDSTFYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHPDGLTSGGEPSGKFWMNEAAALAASKEVLATHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193034_1012017713300019001MarineTWDTASPAYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLTGQLLDDYVTTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193034_1013605013300019001MarinePKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTSVTDHADGTSSGGEPSGKFWMNQAAALAAAKEVLGTHKGLSGKELDAYINTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193034_1013840513300019001MarinePKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTSVTDHADGTSSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQVGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193034_1014035113300019001MarineFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193034_1014507213300019001MarineDTDDIFMRSMIEQYALEEKTKVVKHPDGLVTGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193033_1020954213300019003MarineERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0193044_1027732113300019010MarineIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193569_1018828113300019017MarineNMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193569_1024119613300019017MarineSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193569_1024121513300019017MarineSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193569_1030721113300019017MarineRTTMKFAVAALIGLAAAIKGESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193538_1020244813300019020MarineKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192951_1017312813300019022MarineMKFVVAIFLGFAAAVKVEKDYDASPKFFTTADKDAQYYERQTTPRFSADSDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKSWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192951_1026505713300019022MarineQKDYDASPKFYTPFDHDGTYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193535_1017342513300019024MarineRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193535_1020893413300019024MarineKFAVAALIGLAAAIKGESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193545_1007963013300019025MarineMKFAVAAFIGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193545_1008676913300019025MarineGMKFAVLALIAGAAALKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193545_1008701413300019025MarineMKFAVAALIGLVGAAELAKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQSSAGLAAREVLATHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193545_1009016613300019025MarineGLAAAVKIEKEYDASPKYFTPFDHEATYYERTTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193545_1014183513300019025MarineGSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193545_1014494913300019025MarineGSMIEQYALEERNSVTEHDDGTTSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYINTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0192909_1009424813300019027MarineMKFAVAALIGLASAAQLNKEYDASPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192909_1010684413300019027MarineMGNLFNNLTNSQMKFVVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAKEVLGTHKGMSGKILDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192909_1010822713300019027MarineMKFAYIALLGLVAAKEVDPVPAYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVATYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193516_1018982513300019031MarineMKFAVAALIGAVAAKTYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAREVLGTHKGLGGKMLDDYMETYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192869_1036136513300019032MarineAKEVDPVPAYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVVEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESA
Ga0192869_1046592613300019032MarineAKEVDPVPAYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVVEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0192869_1047481413300019032MarineMGDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAASREVLTTHKGLTGALLDDYMKTYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192945_1020263713300019036MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNTATAKAASSEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192945_1029147413300019036MarineFDHEATYYERVTTPRFEQDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQFMRFFCSDQYMSLGESG
Ga0193123_1019549513300019039MarineMKFAVLAFLGAVAAKDYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0193123_1037096613300019039MarineTYYERVTTPRFSADTDDIFMRSMIENYALEERTKVNEADDGTKSGGEPSGKFWMNQASALAAAKEVLGTHKGLAGKLLDDYITTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193123_1039480713300019039MarineVTPRFSADSDDIFMRSMIEQYALEERNSVTENADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFSKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0193336_1026555713300019045MarineMGNLFNNLTNSQMKFVVAAFLGLAAAVKIDKESDPNPKYYTPFDNEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193336_1026660513300019045MarineMKFIVAAFLGLAAAVKVDKESDPVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNEASAAAAAKEVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193336_1031202213300019045MarineMKFAVAFFLGVASAVKIEKDYDASPKYFTPFDKDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193336_1032437613300019045MarineTWGTMKFAVIALLGCSMVAAKDVEVFASPPYYSPFDDSATYYTRVTTPRFETDGDDIFMRSMIEQYALEERNKVTLHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193336_1042102113300019045MarineGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193336_1045028813300019045MarineMKFAVAALIGLASAAQLNKEYDASPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193336_1045860423300019045MarineMKFAIAALLGLVTVQSVTLGEKKDYFTVFDDKAHYYERVTTPRFSADSDDIFMRSMIENYALEEKTKVVEQPDGLKTGGEPSGKFWMNKQATYAAASEVLNTHKGLSGDGLKAYLDTYFDKAWGHFDVN
Ga0193336_1056517413300019045MarineGTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQASTLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193336_1063335313300019045MarineEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193336_1069191613300019045MarineDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193546_1006010213300019046MarineGDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMXXXXMRFLCSDQYMSLGESG
Ga0192966_1020101813300019050MarineMKFAIAALLGVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0192966_1022327113300019050MarineMKFAIAALLGVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0192966_1022944813300019050MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0192826_1012164013300019051MarineMGELEVTKLAIPMESLDQTNIILSDATAADAQVGGVNLSMKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKTGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1015101213300019051MarineMDQQANIILSDATAVPAQVGEFVNYSKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1015101813300019051MarineMDQQANIILSDATAVPAQVGEFVNYSKDYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1021104613300019051MarineMKFIVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1021707013300019051MarineMKFIVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYLNTYFGKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1022437313300019051MarineMGNLFNNLTNSQMKFVVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGLKTGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMETYFAKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1023528513300019051MarineMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1024107013300019051MarineTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1024553813300019051MarineMKFVLAAFLGLAAAVKIDKDYDASPKYFSTADKDAHFYERVTTPRFSADSDDIFMRSMIEQYALEERTQIHEADDGLKTGGEPSGKFWMNEATTRAAAREVLQTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1024642913300019051MarineMKFVVAIFLGLAAAVKVEKEYDASPKYFTTADKDAHYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHEDDAGLKTGGEPSGKFWMNEATTRAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1025637213300019051MarineHDASPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGTETGGEPSGKFWMNQSAANAAAREVLATHKGLTGTLLEDYMSTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1029470413300019051MarineDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1031781013300019051MarineEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0192826_1032445113300019051MarineVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1035321013300019051MarineFSADTDDIFMRSMIEQYALEEKTKVVKLDNGLTTGGEPSGKFWMNEAAALAAAKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0192826_1038117213300019051MarineDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192826_1038986413300019051MarineMGNLFNNLTNSQMKFVVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLSGQLLEDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYM
Ga0188866_101319023300019095Freshwater LakeRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0188866_102191013300019095Freshwater LakeMKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0188866_102876513300019095Freshwater LakeRTNMKFAVAALIGLAGAAKMDKEVDASPPYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTLHDDGTKSGGEPSGKFWMNQAAATAASKEVLATHKGLSGKLLDDYMNTYFAKAWGHFDVNQVGFIEVIKMPQFMRFLCSDQYMSLQP
Ga0193153_101765813300019097MarineMKFVVAALIGLTAAIKSEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTKVVKHDNGLTSGGEPSGKFWMNEAAALAAAKEVLTTHKGLTGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193153_102164913300019097MarineMKFAVAALIGLAGASQLNKESDPVPKYFTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193153_102270613300019097MarinePKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193153_102385713300019097MarineAAVKVEKEYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193153_102963213300019097MarinePVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193102_101467713300019099MarineMKFAVAALIGLAGAAQLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194243_100746813300019102MarineKVEKDYDASPKYFTTADKDAQYYERTTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0194243_100786813300019102MarineEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVIEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0192946_105993413300019103MarineYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHADGTSSGGEPSGKFWMNQAASLAAAKEVLGTHKGLSGKELAAYIDTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193243_104243513300019116MarinePFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVIEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193243_104437213300019116MarineDKDYFTVFDHESTYYERVTTPRFAADTDDIFMRSMIEQYALEEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLTTHKGLTGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0193243_105015013300019116MarineSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAREVLTTHKGLTGKLLDDYMETYFGKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193243_106489613300019116MarineSADSDDIFMRSMIEQYALEERNSVTEHDDGTTSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYINTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193054_103690113300019117MarineMKFIVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193054_103988213300019117MarinePKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193054_104384413300019117MarineMKFAVAALIGLVGAAELSKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193054_104485613300019117MarineGGAAQLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193157_101729813300019118MarineMKFAVLALLGVVAAKDYDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193157_101844913300019118MarineMKFAIACLLGLVAAKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKITEHDNGLKTGGEPSGKFWMNKSSTLAAAKEVLGTHKGLTGQLLDDYVTTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193157_102953113300019118MarineTPRFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGGLLDDYMKTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193157_103503813300019118MarineSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNMAAANAASKEVLGTHKGLSGKLLDDYMNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193256_105979313300019120MarineAVAALIGLVGASTLNKESDPSPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0192980_106049413300019123MarineTWGTNMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193104_101507613300019125MarineMKFAVAALIGLAGAASINKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLCESG
Ga0193104_101880813300019125MarineATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193104_102363313300019125MarineTTPRFSADTDDIFMRSMIEQYALEEKTKVEEDKVTGLKTGGEPTGKFWMNQSAARAAALEVLGTHKGLSGDLLSNYMDTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193104_103457713300019125MarineMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193104_103712513300019125MarineMKFAVFALLGAVSAVQKEYFTPFDHESTYYERVTTPRFSADTDDIFMRSMIETYALEEKTKVEEDKVTGLKTGGEPTGKFWMNSAAATAAAKEVLTTHKGLTGDLLSNYMDTYYAKAWGHFDVNQTGYIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193104_105411013300019125MarineTTPRFSADTDDIFMRSMIEQYALEEKTKVEEDKVTGLKTGGEPTGKFWMNQSAARAAALEVLGTHKGLSGDLLSNYMDTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0193104_105698813300019125MarineTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193104_105969413300019125MarineADKDAKYYERVTTPRFSADSDDIFMRSMIEQYALEERTQIHEADDGLKSGGEPSGKFWMNEATTRAAAREVLTTHKGLTGKLLDDYMTTYFAKSWGHFDVNQTGMVEVIKMPQLMRFLCSDQYMSLGESG
Ga0193144_108376113300019126MarineDYDASPKFFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0193436_103063013300019129MarineMDQQANIIVSDAVAAEAQVGGFVNVSMKDYDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193436_105634913300019129MarineHGDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193436_105873813300019129MarinePKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193249_110073713300019131MarineMKFAVAALIGLVGASTLNKESDPSPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193089_111765813300019133MarineFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVIEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193047_108655013300019139MarineKFAVAALIGLVGASTLNKESDPSPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0193288_105879513300019145MarineLIGLAGAAQLNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYANTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0188870_1006054913300019149Freshwater LakeRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMQLGESG
Ga0188870_1010396613300019149Freshwater LakeMKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0188870_1011227413300019149Freshwater LakeMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1001705723300019150MarineNKELDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVIEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1004723113300019150MarineMKFVVAIFLGLAAAVKVEKDYDASPKYFTTADKDAQYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0194244_1005120713300019150MarineMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAANAAAKEVLTTHKGLTGELLSNYMDTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1006973413300019150MarineLVGLAAAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGQELAAYITTYFGKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0182097_121130013300019261Salt MarshAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0182059_115355513300019272Salt MarshKFAIAALIGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0182075_158235513300019282Salt MarshMKFAVAALIGLASAATLNKEYDASPKYYTPFDHEATYYERVTPDRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLTGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPSFMRFLASDQYLSLQHY
Ga0182075_176025613300019282Salt MarshGLASASQKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0182058_167890513300019283Salt MarshRTNMKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0206129_1018027113300020182SeawaterLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0211687_1032540313300020396MarineFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0206687_103666313300021169SeawaterMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0206687_144709513300021169SeawaterRTMKFAYIALLGLAAAKELDPSPAYYTPFDSEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVILHDNGLKTGGEPNGKFWMNQSTTLAAAKEVLTTHKGLTGKLLDDYVNTYFAKAWGHFDVNQSGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0210296_103469013300021305EstuarineTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTCGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0210309_103513613300021317EstuarineNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0206696_122108513300021334SeawaterTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0206691_184880913300021342SeawaterRTNMKFAVLAFIGLVSAVKIEKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0206695_138472313300021348SeawaterRTNMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0206692_117131213300021350SeawaterMKFAVAALLGFASVSAIQKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0206692_157614213300021350SeawaterPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0206692_162867613300021350SeawaterMKFAVLALIGAVAAVQKDASPKYFTPFDHAATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDNADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFSKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0206692_163119513300021350SeawaterRTMKFAYIALLGLAAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQASTLAAAKEVLGTHKGLGGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0206692_168672813300021350SeawaterRTNMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0206693_115932813300021353SeawaterRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0206693_144920613300021353SeawaterRTNMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLSGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0063109_10392513300021866MarineNMKFAVAALIGMAAAVQKSYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKINEADDGLKTGGEPSGKFWMNEAATRAAAKEVLGTHKGLAGKLLDDYMETYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0063130_10377713300021867MarineMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063111_10425213300021868MarineLTNMKFAVVCLLGLVAAKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNESASAAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063132_10234613300021872MarineTNMKFAVAALIGLAGAATLDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0063132_11354813300021872MarineVLPPLTRNYDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVTEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063132_11675213300021872MarineYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLATHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063123_105782213300021877MarineFAYIALLGAVAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDSDDIFMRSMIEAYALEERNKVIEHDDGLKTGGEPNGKFWMNHATTLAAAKEVLGTHKGLSGKLLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063118_100382813300021880MarineRTMKFAYIALLAVVAAKDKEVDPSPAYYTPFDHEATYYERVTTPRFSEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063117_100373313300021881MarineMKFAVAALLGFASVSAIQKSYDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063117_100885513300021881MarineTNMKFAVAALIGLAAAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLNTHKGLSGKLLDDYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063117_101370413300021881MarineRTNMKFAVAAFLGLAAAVKVDKSYDASPKYFTPFDHEATYYERATTPRFSADSDDIFMRSMIEQYALEERNQINEAADGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGNLLDDYMKTYFQKAWGHFDVNQTGLLEVIKMPQFMRFLCSDQYMSLGESG
Ga0063117_101801113300021881MarineNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063105_105421913300021887MarineYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063089_107238013300021889MarineKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0063090_102855713300021890MarineNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063137_102049813300021892MarineNMKFAVLALIAGAAALKVEKDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGQELSAYITTYFGKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0063142_100786013300021893MarineRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063120_108490513300021895MarineRTMKFAYVALLGLAAAKELDPSPAYYSPFDNEATYYERVTTPRFSTDGDDIFMRSMIEQYALEERNKITLHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLAGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0063136_104043813300021896MarineMKFAYIALLGLAAAKELDPSPAYYTPFDNEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVILHDNGLKTGGEPNGKFWMNQSTTLAAAKEVLATHKGLTGKLLDDYINTYFAKAWGHFDVNQSGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063097_107490613300021898MarineAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063144_102577913300021899MarineMKFAYIALLGLAAAKELDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKTGGEPNGKFWMNQASTLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063144_104042413300021899MarineKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063144_105799713300021899MarineKFAVLALLGVVAAKDYDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFTKSWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0063135_101156513300021908MarineMKFAVLALIAGAAALKVEKDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGQELSAYITTYFGKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0063133_100201713300021912MarineRTNMKFAVALFLGVAAAVKIEKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLSSDQYMSLGESG
Ga0063133_100487313300021912MarineRTNMKFAVLALVGLVSAVKVDKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063133_101000113300021912MarineMKFAVALFLGVAAAVKVQKDYDASPKFFTPFDHDATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTSAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0063133_101349213300021912MarineVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063104_102409813300021913MarineNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063085_100940113300021924MarineTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063085_112875913300021924MarineAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0063103_108760913300021927MarineFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP
Ga0063145_106280913300021930MarineTTMKFAVAALLGFASVSAIQKSYDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063139_100710813300021934MarineAIKTGDYFTVFDEGHPGGYARATTARFSADSDDIFMRSMIQQYALEEKTPVEKLANGLSTGGEPSGKFWMNEAAALAAAKEVLGTHKGLSGKLLDDYINTYFKKSWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0063139_101262413300021934MarineMKFVIAALIGATAAIQNKDYFTTFDEGNPGGYARATTARFSADTDDIFMRSMIQQYALEEKTPVEKLANGLSIGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0063138_100598013300021935MarineTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0063138_101271413300021935MarineMKFAYIALLGLVAAKEVDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLATHKGLTGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0063101_105986313300021950MarineKMKFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP
Ga0224906_107589913300022074SeawaterMKFAVAALIGLVGAAQLNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFSKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0224906_122325713300022074SeawaterERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWVNEAAANAAAREVLTTHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0210312_11064413300022367EstuarineNMKFAVAAFIGLGAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0232120_10678013300023555SeawaterNQDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0228679_102247513300023566SeawaterMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228697_12149213300023674SeawaterGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0228681_103603713300023683SeawaterDYFTVFDHESTYYERAVTPRFSADSDDIFMRSMITNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0228681_103643313300023683SeawaterRAVTPRFSADSDDIFMRSMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGES
Ga0228680_102630813300023695SeawaterTNMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228682_102651413300023698SeawaterRTNMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228682_103683613300023698SeawaterNMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0228682_103990413300023698SeawaterTMKFVIAALIGLATAVQVEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0228682_104163913300023698SeawaterNMKFVIAALIGLAATVKVDKDYFTVFDHESTYYERVTTPRFSSDSDDIFMRSMIENYALEEKTKVVEHDDGTKSGGDPSGKFWMNEAAALAASKEVLGTHKGLAGGMLDAYINTYFKKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0228682_104436513300023698SeawaterLENQDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0228695_106067613300023699SeawaterNMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228685_103052613300023701SeawaterIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228684_105287013300023704SeawaterRTNMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTENDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYIQTYFGKAWGHFDVNQVGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228684_105584013300023704SeawaterTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQIGESG
Ga0228684_105947813300023704SeawaterNMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0232122_110950913300023709Salt MarshKFAVAAFIGLVAGAKLDKESDPVPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYIATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0228671_110850413300024334SeawaterATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209634_116677213300025138MarineDSEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVILHDNGLKTGGEPNGKFWMNQSTTLAAAKEVLTTHKGLTGKLLDDYVNTYFAKAWGHFDVNQSGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0209634_125293113300025138MarineMKFAVALFLGVAAAVKVQKDYDASPKFFTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0209634_130231713300025138MarineDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLSGKLLDDYMTTYFAKSWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0209716_106842113300025626Pelagic MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209716_114689213300025626Pelagic MarineMKFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0209306_106709423300025680Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209602_123159213300025704Pelagic MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQF
Ga0209603_124003923300025849Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLG
Ga0209335_1026100713300025894Pelagic MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVN
Ga0247557_103136913300026403SeawaterMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247557_103837513300026403SeawaterVAAFLGLATAVQLENKDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247581_104768113300026420SeawaterTNMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247580_107811413300026423SeawaterKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247559_109791013300026443SeawaterMKFAVAAFLGLAAAVSIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247607_103543113300026447SeawaterAVQVEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247607_103749913300026447SeawaterTNMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247607_105929813300026447SeawaterMKFIVAAFLGLATAVQLENQDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247607_107632413300026447SeawaterLIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247607_109851913300026447SeawaterRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247594_107371613300026448SeawaterRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMSFLCSDQWMQLGESA
Ga0247594_108479813300026448SeawaterMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247594_110350013300026448SeawaterADSDDIFMRSMITNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247593_108020513300026449SeawaterKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDTFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247593_108877513300026449SeawaterIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247578_107786913300026458SeawaterMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTENDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYIQTYFGKAWGHFDVNQVGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247578_108236713300026458SeawaterGIKESTPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247578_112698713300026458SeawaterDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247600_108885613300026461SeawaterMKFVIAALIGLATAVQVEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247600_111640813300026461SeawaterKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMTLGESG
Ga0247568_104432013300026462SeawaterNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0247568_112938013300026462SeawaterDTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247588_107257213300026465SeawaterMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247588_109396913300026465SeawaterMKFVIAALIGLATAVQVEKDYFTVFDHESTYYERAVTPRFSADSDDIFMRSMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247588_112231113300026465SeawaterMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQWMQLGESA
Ga0247588_112557413300026465SeawaterFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247603_109791513300026468SeawaterKFVIAALIGLATAVQVEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247603_110058813300026468SeawaterMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLASDQYMQLGESG
Ga0247603_113504413300026468SeawaterSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247599_102107923300026470SeawaterMNIYFLRIKIFGRFFKTPFFIPRVVYLFFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGES
Ga0247599_110087013300026470SeawaterRTNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQRMALGEA
Ga0247599_111253413300026470SeawaterPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKEFEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247599_111995313300026470SeawaterTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247571_104998213300026495SeawaterMKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247571_108619213300026495SeawaterRTNMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQWMQLGESA
Ga0247592_111270313300026500SeawaterKFAIAALLGLATASQKVKELDPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKEFEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247605_108746913300026503SeawaterMKFIVAAFLGLASAVSLEKDYFTVFDHESTYYERAVTPRFSADSDDIFMRSMITNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247605_111116313300026503SeawaterRTMKFAIAALLGLASASQKVKELDPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247587_105930613300026504SeawaterMKFAVAAFLGLAAAVSIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247590_112319913300026513SeawaterTNMKFIVAAFLGLATAVQLENKDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMITNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247590_117670213300026513SeawaterERAVTPRFSADSDDIFMRSMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247590_119053713300026513SeawaterSTPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0209710_112405513300027687MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209710_113511523300027687MarineMKFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP
Ga0209710_115063123300027687MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209091_1042411213300027801MarineLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP
Ga0209092_1028189413300027833MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0228674_114306713300028008SeawaterYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247563_110267913300028095SeawaterYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247576_104819613300028099SeawaterNMKFAVAAFLGLAAAVSIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247586_106263413300028102SeawaterKFAVAAFIGLAAGAKLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247596_110222413300028106SeawaterLIGLATAVQVEKDYFTVFDHDSTYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247596_111254113300028106SeawaterAATVKVDKDYFTVFDHESTYYERVTTPRFSSDSDDIFMRSMIENYALEEKTKVVEHDDGTKSGGDPSGKFWMNEAAALAASKEVLGTHKGLAGGMLDAYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0247596_113050513300028106SeawaterIMKFVIAALIGLATAVQVEKDYFTVFDHESTYYERAVTPRFSADSDDIFMRSMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247596_113537813300028106SeawaterERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247582_113409313300028109SeawaterAAAHQGIKESTPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247584_117738013300028110SeawaterYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPCGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQRMALGEA
Ga0247561_12129813300028119SeawaterMITNYALEEKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLAVKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256411_112272813300028134SeawaterKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256412_118071513300028137SeawaterNMKFAVLALIGAVAAVQKDASPKYFTPFDHAATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVSDNADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFSKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0256412_118543113300028137SeawaterFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0256412_124213213300028137SeawaterRTNMKFVIAALIGLAATVKVDKDYFTVFDHESTYYERVTTPRFSSDSDDIFMRSMIENYALEEKTKVVEHDDGTKSGGDPSGKFWMNEAAALAASKEVLGTHKGLAGGMLDAYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0256412_128217413300028137SeawaterIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKELDAYIQTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256412_131528413300028137SeawaterYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0256412_134326813300028137SeawaterMKFAIAALLGLVAVQAVTVGDYFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWKHFDVNQSGTIEVLKMP
Ga0257106_130415213300028194MarinePSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256417_112396213300028233SeawaterSASQKVKELDPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKEYEDTATGLKTGGEPNGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0256417_115781513300028233SeawaterIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256417_117660513300028233SeawaterRTMKFAIAAFLGLAAAHQGIKESTPSPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGMFWMNHASTLAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0256417_118555313300028233SeawaterKLFTMKFAIAALLGLVAVQAVSVSEVDYYTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFICSDQYMSLGESG
Ga0256417_118743613300028233SeawaterKFAIAALLGLVAVQAVTVGDYFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWKHFDVNQSGTIEVLKMP
Ga0256413_113803623300028282SeawaterGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0256413_114572713300028282SeawaterKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0256413_127985913300028282SeawaterMKFAVLALIAGAAALKVEKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKTPVKKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGKLLDDYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247572_106666313300028290SeawaterMKFAVAALIGLVGASTLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSL
Ga0247572_112077513300028290SeawaterRTIMKFVIAALIGLATAVQVEKDYFTVFDHESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247601_106045713300028330SeawaterNMKFAVAALIGLVGAAKLDKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKLLEDYVNTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247595_108528713300028333SeawaterESTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0247597_105563313300028334SeawaterTYYERAVTPRFSADTDDIFMRSMISNYALEEKTPVKKLDNGLSVGGEPSGKFWMNEAAANAAAKEVLGTHKGLAGKLLDDYMNTYFKKAWGHFDVNQTGFIEVIKMPQLMRFLCSDQYMQLGESG
Ga0304731_1004509423300028575MarineMRSMIEQYALEERTKVVEEDNGLKHGGEPSGKFWMNQAAANAAAREVLTTHKGLTGDLLSNYMDTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0304731_1021249113300028575MarineYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNPVDNLANGLTTGGEPSGKFWMNESTALAAAKEVLTTHKGLTGKLLDDYINTYFGKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMQLGESG
Ga0304731_1024692813300028575MarineMKFAIAALLGLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTSTGLKTGGEPSGKFWMNKASTFAAAKEVIGTHKGLTGKMADDYLNTYFDKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0304731_1030736513300028575MarineRTTMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQSAANAAAREVLGTHKGLTGQLLEDYMSTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0304731_1093548713300028575MarineNMKFAVAAFIGLVAAVKVDKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAAANAAAREVLATHKGLTGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQMMRFLCSDQYMSLGESG
Ga0304731_1097199313300028575MarineMKFAVAAFLSLAAAVQIDKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEADDGLKSGGEPSGKFWMNEASAASAAREVLGTHKGLSGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0304731_1115662713300028575MarineVAAFIGLAAAITVDKESDPSPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERAKEYKDTDTGLKTGGEPTGKFWMNHAATLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0304731_1126510913300028575MarineKFAVAAFIGLAAAVKMDKESDPSPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIKKYAVEERTDTEELDDGTKIGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0257128_107978313300028672MarineMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307401_1036152213300030670MarineMKFAIAALIGVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307401_1045432013300030670MarineMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGGFEAIKMPQFLRFLASDQYFQFMFPTAPVTLKA
Ga0307401_1051352813300030670MarineFAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0307403_1053257213300030671MarineKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGNIEVIKMPQLMRFLCSDQYMSLGESG
Ga0307398_1051348113300030699MarineMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308127_104232813300030715MarineKKMKFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0308127_104279513300030715MarineKMKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308133_103883913300030721MarineAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308133_105302013300030721MarineKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP
Ga0308129_102695213300030723MarineKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308129_102724613300030723MarineVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308138_105753613300030724MarineFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0308128_103233513300030725MarineITMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLQ
Ga0308128_103691913300030725MarinePHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308128_104122613300030725MarineAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0073969_1000736013300030749MarineTKLAIPMESLDQTNIILSDATAADAQVGGVNLSMKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQ
Ga0073968_1197704513300030756MarineLAIPMESLDQTNIILSEATAAEAQVGGVDLSMKDYDASPKYFTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073988_1000430713300030780MarineHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKVIEHDDGLKTGGEPNGKFWMNKSTTLSAAKEVLGTHKGLSGKLLDDYINTYFDKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0073988_1000703313300030780MarineMKFAYIALLGLAAAKELDPVPAYFTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKITEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0073988_1235962513300030780MarineAGAAQLNKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073988_1236766313300030780MarineMKFAYAALLGLVAGIKKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAANAAAKEVLTTHKGLTGDLLANYMDTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073965_1179117813300030787MarineDIPIPMDPQANIIVSDATAAEAQVGGLVKFSMKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073964_1163462113300030788MarineQANIIVSDAVAAEAQVGGFVNLSMKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1000393713300030856MarineRTNMKFAVLALLGVVSAIEKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAASKEVLATHKGLSGKLLDDYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1002145413300030856MarineMKFAVLALIGAVAAVQKDASPKYYTPFDHAATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTENADGTTSGGEPSGKFWMNQSAALAAAKEVLGTHKGLSGKELDAYIATYFAKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1002384013300030856MarineSPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHDDGTSSGGEPSGKFWMNQSATLAAAKEVLGTHKGLSGKELDAYIATYFGKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1191090813300030856MarineLFTMKFAIAALLGLVAVQAVNVSEVDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQTGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1200200913300030856MarinePFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTLHDDGTKSGGEPSGKFWMNQAAALAASKEVLGTHKGLSGKLLDDYINTYFAKTWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1202414713300030856MarineSIKMKFAIAALLGLVAVQAVTIDKEPDYFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKIIEHDDGTKTGGEPTGKFWMDYNTSKAAAAEVLGTHKGLHGAALQTYLDTYYDKAWRHFDVNQSGTIEVIKMP
Ga0073990_1203936613300030856MarineTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKTGGEPSGKFWMNEAGAAAAAREVLNTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0073990_1204015713300030856MarinePKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAKEVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073990_1205942813300030856MarineRFSADTDDIFMRSMIEQYALEERTKVVEHDDGQKTGGEPSGKFWMNEAAATAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMP
Ga0073981_1000626813300030857MarineDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAREVLGTHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073981_1166255813300030857MarineKTFCKETSWEKTTAIKTAKAAIEDLSADIDKAGADALVAAKEIDPVPAYYTPFDHEATYYERVTTPRFSSDDDDIFMRSMIEQYALEERSKIIEHDDGLKTGGDPTGKFWMNHSTTLAAAKEVLATHKGLTGKLLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0073981_1169909113300030857MarineMKFAVAAFLGLAAAVKVDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073981_1170403213300030857MarineKFAVALFLGVAAAVKVQKDYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0073981_1172887813300030857MarineRTTMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTEVTDHDDGTSTGGEPSGKFWMNQAAANAAAREVLTTHKGLTGQLLEDYMSTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0151492_105053713300030869MarineIPIPMDQQANIIVSDAVAAEAQVGGFVNFASKDAVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGQKTGGEPSGKFWMNEAAATAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0151493_13535613300030870MarineRTNMKFIVAAFLGLAAAVKIDKEYDASPKYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNQVHEAADGLKTGGEPSGKFWMNEAATRAAAREVLGTHKGLSGQLLDDYMNTYFAKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG
Ga0073956_1094209913300030910MarineDQYMSLGESGRRLKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESGRRL
Ga0073987_1121394813300030912MarineRTNMKFAVLALLGAVSAVQRDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHDDGTSSGGEPSGKFWMNQSATLAAAKEVLGTHKGLSGKELDAYIATYFGKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0073987_1121728313300030912MarineMKFAVAALIGLVGAAELSKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVATYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073985_1086557413300030918MarineANIIVSDAVAAEAQVGGFVNLSMKDYDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLASDQYMSLQ
Ga0073938_1216490413300030952MarineRTNMKFAVAAFLGLAAAVKVDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMTTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073944_1115107713300030956MarineMKFAVAAFLGLAAAVKVDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMTTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073984_1000670413300031004MarineLLGLVAAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073984_1125251913300031004MarineTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKITEHDNGLKTGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0073984_1126097713300031004MarineMKFVVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMP
Ga0073974_174862013300031005MarineIPIPMDQQANIIVSDAVAAEAQVGGFVNFASKDAVPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073980_1135464713300031032MarineRTTMKFAVLALIGVVSAGSHDASPKYYTPFDHEATYYERATTPRFSADTDDIFMRSMIEQYALEERTQVTDHDDGTSSGGEPSGKFWMNQSAANAAAREVLTTHKGLTGTLLEDYMSTYFGKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073980_1136298613300031032MarineMKFAVALFLGVAAAVKVQKDYDASPKYFTPFDHEATYYERQTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGASAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQLMRFLCSDQYMSLGESG
Ga0073980_1138695313300031032MarineTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTEHDDGTTSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYINTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0073980_1139707313300031032MarinePKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHSDGLKTGGEPSGKFWMNQASALSASKEVLATHKGLSGKMLEDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073979_1000411913300031037MarineRTMKFAYIALLGLVAAKEVDPVPAYYTPFDHEATYYERVTTPRFAEDTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQASTLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0073979_1000746513300031037MarineMKFAYIALLGTVAAAPKELDPSPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKVIEHDDGLKTGGEPNGKFWMNQATTLSAAKEVLGTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0073979_1001240813300031037MarineRTTMKFAVAALLGFASVSAIQKSYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYITTYFAKAWGHFDVNQTGFIEVIKMPQMMRFLCSDQYMSLGESG
Ga0073979_1229845813300031037MarineNMKFVVAIFLGLAAAVKVEKDYDASPKYFTTADKDAQYYERTTTPRFSADSDDIFMRSMIEQYALEERTKVHESDDGLKSGGEPSGKFWMNEATTRAAAREVLGTHKGLAGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0073986_1000023013300031038MarineTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKVIEHDNGLKSGGEPNGKFWMNQAATLAAAKEVLGTHKGLSGKLLDDYINTYFGKAWGHFDVNQTGYVEVIKMPQFMRFLCSDQYMQLGESG
Ga0073986_1000179313300031038MarineVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073986_1000366813300031038MarineRTNMKFAVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGQKTGGEPSGKFWMNEAAATAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFIEVIKMP
Ga0073986_1000544213300031038MarineMKFAAAALIGFVGAAELAKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073986_1204613513300031038MarineLTNSQMKFVVAAFLGLAAAVKIDKEYDASPKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAKEVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073989_1000022713300031062MarineYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNSVTDHDDGTSSGGEPSGKFWMNQSATLAAAKEVLGTHKGLSGKELDAYIATYFGKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMSLGESG
Ga0073989_1000909813300031062MarineRTNMKFAVAALIGLVGAAELNKESDPVPKYYTPFDHEATYYERVTPARFSADTDDIFMRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073989_1000986413300031062MarineMKFAYAALLGLVSAGIKDYDATPKYYSPFDHEATYYERVTTPRFSADSDDIFMRSMIENYALEERNKMFEDTVTGLKTGGEPTGKFWMTESTTKAAAREVLGTHKGLSGKLLDDYMTTYFGKAWAHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0073989_1001715613300031062MarineMKFAYLALLGVVAAKEIDPVPAYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNKVIEHDDGLKTGGEPNGKFWMNKSTTLSAAKEVLGTHKGLSGKLLDDYINTYFDKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG
Ga0073989_1002265813300031062MarineMKFAYAALLGLVSAGIKDYDATPKYYTPFDHEATYYERVTTPRFSSDDDDIFMRSMIENYALEERNKMFEDTTTGLKTGGEPTGKFWMNESTTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0073989_1345857213300031062MarineMKFAIVALLGLVAAKEYDATPKYYSPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERTKVHEDETSGLKTGGEPTGKFWMNKATTEAAAKEVLGTHKGLSGKLLGDYMATYFDKAWGHFDVNQSGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0073989_1350069213300031062MarinePKYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGKELDAYITIYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073989_1351552513300031062MarineAIAALLGLVAVQAVTVGDYFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKSKIVEHDDGTKTGGEPTGKFWMNKDDAMSAAKEVLDTHKGMTGGALDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0073989_1353003713300031062MarineAVKIEKDYDASPKYFTPFDKDATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVHEADDGLKSGGEPSGKFWMNEAGTRAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGLVEVIKMPQLMRFLCSDQYMSLGESG
Ga0073989_1354635413300031062MarineIDPVPAYYTPFDHEATYYERVTTPRFSSDDDDIFMRSMIEQYALEERSKIIEHDDGLKTGGDPTGKFWMNHSTTLAAAKEVLATHKGLTGKLLDDYINTYFEKAWGHFDVNQTGFVEVIKMP
Ga0073989_1357847513300031062MarineHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLSGKLLDDYMTTYFAKAWGHFDVNQTGMIEVIKMPQLMRFLCSDQYMSLGESG
Ga0073989_1359104713300031062MarineMKFALVAFLGLAAAVKIEKEYDASPKYFTPFDHEATYYERTTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEAAANAAAREVLGTHKGLSGKMLDDYMTTYFAKAWGHFDVNQTGLIEVIKMPQFMRFLCSDQYMSLGESG
Ga0073989_1361052313300031062MarineRTTMKFAYAALLGLVAGIKKEYDASPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDNGLKTGGEPSGKFWMNQAAANAAAKEVLTTHKGLTGDLLANYMDTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0138347_1014910313300031113MarineMKFAVAALIGLVGAAELSKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0138345_1008405613300031121MarineMKFAVAALIGLVGAAELSKESDPVPKYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNQASALAAAKEVLATHKGLSGKMLDDYVATYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307388_1098445013300031522MarineTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308143_12351613300031540MarineAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0308143_12721813300031540MarineKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0307392_106359913300031550MarineLLGVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0308148_101751813300031557MarineRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308144_103126313300031570MarineTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308144_103562713300031570MarineKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308144_104339213300031570MarineLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0302114_1027932013300031621MarineDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVTEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0302114_1036507113300031621MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSD
Ga0302126_1031604813300031622MarineMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRITTPRFAADSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQ
Ga0302125_1028210213300031638MarineMKFAIAALLGLVAVQAVTIGDFFTPHDHEAHYYERITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDV
Ga0307393_113700313300031674MarineAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMSLGESA
Ga0307396_1035709213300031717MarineVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307396_1057428713300031717MarineTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307381_1025463213300031725MarineLAAASDKIKELDPSPAYYTPFDHEATYYERVTTPRFEQDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQFMRFFCSDQYMSLGESG
Ga0307381_1025580013300031725MarineRTNMKFAIAALIGLAGAAQVEKEIDPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVIEHGDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLASDQYMALW
Ga0307391_1055676213300031729MarineQITMKFVIAAFLGLVSVQAVTVSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307391_1080829813300031729MarineQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0307397_1041852213300031734MarineQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVIEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307394_1033523213300031735MarineMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMALQ
Ga0307384_1043220013300031738MarineTMKFVIAAFLGLVSVQAVTVSDYFTVQDNESHYYERVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGNIEVIKMPQLMRFLCSDQYMSLGESG
Ga0307383_1052766813300031739MarineSDKIKELDPSPAYYTPFDHEATYYERVTTPRFEQDSDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQFMRFFCSDQYMSLGESG
Ga0307395_1043585913300031742MarineVVAVQAVTIGDYFTPHDHEAHYYDRVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307395_1053888613300031742MarineLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0307382_1025679413300031743MarineSDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307382_1049069513300031743MarineYTPFDHEATYYERITTPRFSSDDDDIFMRSMIEQYALEERSKVYEHDDGLKSGGDPTGKFWMNHSTTLAAAKEVLTTHKGLTGKLLDDYVNTYFEKAWGHFDVNQVGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0307389_1074213713300031750MarineMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLCESG
Ga0307389_1083198713300031750MarineMNFAIADLLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0307389_1094215913300031750MarineYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0315330_1062233913300032047SeawaterKEVDPVPAYFTPFDHEATYYERVTTPRFSADTDDIFMRSMIEQYALEERNKKYTDSTTGLSTGGEPSGKFWMNHASTLAAAKEVLGTHKGLSGKMLDDYVNTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0315330_1069157413300032047SeawaterYYTPFDHEATYYERVTTPRFSADSDDIFMRSMIEQYALEERNQVTEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGQELAAYVQTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0315330_1088262413300032047SeawaterLDKEIDPVPAYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0314670_1043467613300032470SeawaterTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314670_1053087513300032470SeawaterSIKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314668_1047159413300032481SeawaterFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314688_1052267013300032517SeawaterTMKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314680_1065989313300032521SeawaterIKKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314680_1075920213300032521SeawaterKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314682_1046322913300032540SeawaterINKKMKFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0314682_1065890413300032540SeawaterNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314674_1053298813300032615SeawaterLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314671_1041977113300032616SeawaterMFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314671_1047049513300032616SeawaterRTMKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314683_1067110813300032617SeawaterMKFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTSTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314683_1067442213300032617SeawaterIKMKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314673_1065967413300032650SeawaterTYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314685_1050475713300032651SeawaterNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERATPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314678_1003404413300032666SeawaterMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314678_1043340713300032666SeawaterFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314687_1028795713300032707SeawaterSIKAQRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314686_1048864213300032714SeawaterKMNFAIAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314703_1038930013300032723SeawaterTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314695_131631713300032724SeawaterKFAIAALLGLVAVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGDALNTYLATYFDKAWRHFDVNQSGAVEVIKMP
Ga0314702_131468913300032725SeawaterIKMKFAIAALLGFFAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314698_1056679913300032726SeawaterLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314693_1061753713300032727SeawaterIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314699_1022363323300032730SeawaterRTNMKFAVAAFIGLVAGAKLDKESDPSPKYYTPFDHEATYYERTTPARFSADTDDIFMRSMIEQYALEERTKVIEHDDGLKTGGEPSGKFWMNQASAMSAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314699_1032255713300032730SeawaterSKTQMVNHKTLSCKTKVIRISIHNSHNKWGLVNGNAALLGLVAVQAVTIGDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGAVEVIKMP
Ga0314710_1034464913300032742SeawaterVQAVTVTDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314707_1066800413300032743SeawaterFAIAAFVGLAAASQKIKEIDPSPAYYTPFDHEATYDERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314701_1048468613300032746SeawaterGLAAASQKIKEIDPSPAYYTPFDHEATYYERATTPRFAEDTDDIFMRSMIEQYALEERNKEYKDTTTGLKTGGEPSGKFWMNHASTFAAAKEVIATHKGLTGKMADDYLNTYFEKSWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0314712_1049816413300032747SeawaterKFAIAALLGFVAVQAVTVSDYFTPHDHEAHYYDRITTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314700_1032732513300032752SeawaterITMKFVIAAFLGLVAVQAVTVDDYFTVQDHESHYYDRVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAAASEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307390_1062405313300033572MarineMKFAIAALLGVVAVQAVTVSDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNTATAKAASSEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307390_1062458713300033572MarineFAIAALLGLVAVQAVTITDYFTPHDHEAHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307390_1091413913300033572MarineRTNMKFAIAAFIGLVSAAQVEGDSTPVPAYYTPFDHEATYYERVTTPRFSADTDDIFMRSMIEAYALEERTKVTEHSDGLKTGGEPSGKFWMNQASALAASKEVLATHKGLAGKMLDDYTNTYFAKAWGHFDVNQTGSFEAIKMSQFLRFLASDQYFQFMFPTAPVTLKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.