NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F001240

Metagenome / Metatranscriptome Family F001240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F001240
Family Type Metagenome / Metatranscriptome
Number of Sequences 739
Average Sequence Length 156 residues
Representative Sequence LAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Number of Associated Samples 326
Number of Associated Scaffolds 739

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.27 %
% of genes near scaffold ends (potentially truncated) 83.36 %
% of genes from short scaffolds (< 2000 bps) 99.86 %
Associated GOLD sequencing projects 295
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.729 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(49.120 % of family members)
Environment Ontology (ENVO) Unclassified
(74.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.250 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.18%    β-sheet: 12.30%    Coil/Unstructured: 46.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.80.1.1: SIS domaind1moqa_1moq0.51
d.133.1.1: Molybdenum cofactor-binding domaind1t3qb21t3q0.5
c.80.1.0: SIS domaind4s1wa_4s1w0.5
c.80.1.0: SIS domaind7kqaa17kqa0.5


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 739 Family Scaffolds
PF03462PCRF 0.14

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 739 Family Scaffolds
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.14
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.14


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.86 %
UnclassifiedrootN/A0.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10201678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300003303|Ga0006246J48908_1076312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300003677|Ga0008458J53046_103172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300006357|Ga0075502_1547209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300006399|Ga0075495_1564792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300006401|Ga0075506_1797571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300006403|Ga0075514_1703883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300006419|Ga0075496_1432590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300006602|Ga0075484_1486466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300006728|Ga0031676_1007898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300007864|Ga0105749_1163219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300007957|Ga0105742_1023211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300007958|Ga0105743_1016630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300008832|Ga0103951_10713193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300008835|Ga0103883_1060917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300008938|Ga0103741_1078430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300008956|Ga0104261_1004137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium1456Open in IMG/M
3300008958|Ga0104259_1023101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300008958|Ga0104259_1028753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300008993|Ga0104258_1076080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300008993|Ga0104258_1098812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300009022|Ga0103706_10105482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009022|Ga0103706_10187879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009025|Ga0103707_10084295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300009025|Ga0103707_10192206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300009071|Ga0115566_10839334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300009077|Ga0115552_1164365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium925Open in IMG/M
3300009077|Ga0115552_1175859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium887Open in IMG/M
3300009172|Ga0114995_10313395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300009193|Ga0115551_1274074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300009193|Ga0115551_1446645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300009263|Ga0103872_1035214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300009263|Ga0103872_1041555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300009263|Ga0103872_1050302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300009263|Ga0103872_1059973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300009263|Ga0103872_1064475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300009265|Ga0103873_1034056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum923Open in IMG/M
3300009265|Ga0103873_1064810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300009265|Ga0103873_1072627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300009265|Ga0103873_1078731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300009265|Ga0103873_1094334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300009357|Ga0103827_1008588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300009436|Ga0115008_10445439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum921Open in IMG/M
3300009437|Ga0115556_1230540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300009445|Ga0115553_1159851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium919Open in IMG/M
3300009496|Ga0115570_10194307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium921Open in IMG/M
3300009497|Ga0115569_10374666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300009498|Ga0115568_10419052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300009508|Ga0115567_10344755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium925Open in IMG/M
3300009526|Ga0115004_10316660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium925Open in IMG/M
3300009526|Ga0115004_10344552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium883Open in IMG/M
3300009543|Ga0115099_10607771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300009543|Ga0115099_10683589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300009543|Ga0115099_10719594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300009543|Ga0115099_10720028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300009543|Ga0115099_10912930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300009543|Ga0115099_11043701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300009592|Ga0115101_1654839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300009592|Ga0115101_1848685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300009599|Ga0115103_1027861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300009599|Ga0115103_1075154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300009599|Ga0115103_1103144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300009599|Ga0115103_1381261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300009599|Ga0115103_1430241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300009599|Ga0115103_1448172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300009606|Ga0115102_10490069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300009606|Ga0115102_10600078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300009606|Ga0115102_10629901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300009606|Ga0115102_10814744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300009608|Ga0115100_10009757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300009608|Ga0115100_10329513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009608|Ga0115100_10672367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300009608|Ga0115100_10863830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300009608|Ga0115100_10866073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300009608|Ga0115100_10880935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300009608|Ga0115100_11050510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300009608|Ga0115100_11153326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300009677|Ga0115104_10097464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300009677|Ga0115104_10289819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300009677|Ga0115104_10452394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300009679|Ga0115105_10405738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300009679|Ga0115105_10797605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300009679|Ga0115105_11053851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300009705|Ga0115000_10386919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium893Open in IMG/M
3300009732|Ga0123373_101159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300009732|Ga0123373_155559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300009741|Ga0123361_1076434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300009785|Ga0115001_10517190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300009785|Ga0115001_10583582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300010299|Ga0129342_1216052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300010981|Ga0138316_10045716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300010981|Ga0138316_10318892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300010981|Ga0138316_10453360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300010981|Ga0138316_10764086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300010981|Ga0138316_10821825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300010981|Ga0138316_11141651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300010985|Ga0138326_10126627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300010985|Ga0138326_10143597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300010985|Ga0138326_10241674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300010985|Ga0138326_10380800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300010985|Ga0138326_11149102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300010985|Ga0138326_11483393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300010985|Ga0138326_11598931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300010987|Ga0138324_10413185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300010987|Ga0138324_10440441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300010987|Ga0138324_10506594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300010987|Ga0138324_10516496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300010987|Ga0138324_10606330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300010987|Ga0138324_10662561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300011312|Ga0138349_1126871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300012470|Ga0129329_1066905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300012470|Ga0129329_1070696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300012472|Ga0129328_1102590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300012472|Ga0129328_1112121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium793Open in IMG/M
3300012504|Ga0129347_1277531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300012518|Ga0129349_1080152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300012518|Ga0129349_1256257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300012518|Ga0129349_1329229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300012518|Ga0129349_1364774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300012518|Ga0129349_1461266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300012520|Ga0129344_1239612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300012520|Ga0129344_1352368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300012523|Ga0129350_1109680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300012523|Ga0129350_1177034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300012523|Ga0129350_1346763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300012523|Ga0129350_1477830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300012524|Ga0129331_1074348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300012524|Ga0129331_1414837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300012525|Ga0129353_1328754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300012525|Ga0129353_1969209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300012528|Ga0129352_10293341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300012528|Ga0129352_11035410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300012954|Ga0163111_11224406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300012966|Ga0129341_1189407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300012969|Ga0129332_1012558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300012969|Ga0129332_1319494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300016726|Ga0182045_1135815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300016736|Ga0182049_1127287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300016737|Ga0182047_1189079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300016766|Ga0182091_1494513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300017697|Ga0180120_10222882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300017748|Ga0181393_1080238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300017749|Ga0181392_1223083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300017770|Ga0187217_1134739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300017771|Ga0181425_1111512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum874Open in IMG/M
3300017772|Ga0181430_1149282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300017783|Ga0181379_1194193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300018515|Ga0192960_104209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300018556|Ga0192942_105118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300018596|Ga0193060_1014103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300018602|Ga0193182_1013318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300018625|Ga0192842_1025370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018628|Ga0193355_1012924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300018628|Ga0193355_1014488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium724Open in IMG/M
3300018628|Ga0193355_1022423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300018649|Ga0192969_1038923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018649|Ga0192969_1053255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300018661|Ga0193122_1057915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300018671|Ga0193571_1016902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300018674|Ga0193166_1019910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300018692|Ga0192944_1033342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300018692|Ga0192944_1033343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300018692|Ga0192944_1037675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300018692|Ga0192944_1038513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300018692|Ga0192944_1039153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300018692|Ga0192944_1061368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300018701|Ga0193405_1027526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300018701|Ga0193405_1036000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300018701|Ga0193405_1042094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300018730|Ga0192967_1024651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium975Open in IMG/M
3300018730|Ga0192967_1048366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300018730|Ga0192967_1068726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300018735|Ga0193544_1020903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018735|Ga0193544_1022544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018739|Ga0192974_1057608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018741|Ga0193534_1056707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300018742|Ga0193138_1031364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300018742|Ga0193138_1034584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300018742|Ga0193138_1034585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300018742|Ga0193138_1036854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018742|Ga0193138_1038782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300018742|Ga0193138_1041170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018742|Ga0193138_1056200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300018745|Ga0193000_1038381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300018745|Ga0193000_1050684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018746|Ga0193468_1055636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300018762|Ga0192963_1053745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300018762|Ga0192963_1063302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018763|Ga0192827_1049022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300018763|Ga0192827_1054598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300018763|Ga0192827_1064225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300018763|Ga0192827_1064269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300018763|Ga0192827_1068015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300018763|Ga0192827_1077933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300018763|Ga0192827_1090763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018763|Ga0192827_1093329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018765|Ga0193031_1048267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300018765|Ga0193031_1051547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300018765|Ga0193031_1052240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018765|Ga0193031_1053515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300018765|Ga0193031_1055619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300018765|Ga0193031_1065303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300018765|Ga0193031_1071140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300018765|Ga0193031_1072180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300018765|Ga0193031_1081682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300018765|Ga0193031_1082297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018765|Ga0193031_1085589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018765|Ga0193031_1085937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300018765|Ga0193031_1086360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300018765|Ga0193031_1092811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018766|Ga0193181_1035930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300018766|Ga0193181_1053426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018766|Ga0193181_1054585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018776|Ga0193407_1042239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300018776|Ga0193407_1044199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018776|Ga0193407_1058004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300018778|Ga0193408_1073191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018779|Ga0193149_1046171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018779|Ga0193149_1066937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300018782|Ga0192832_1055870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300018787|Ga0193124_1040056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300018787|Ga0193124_1051784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300018787|Ga0193124_1053824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018787|Ga0193124_1065216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300018791|Ga0192950_1042275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300018791|Ga0192950_1042834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300018791|Ga0192950_1073233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018796|Ga0193117_1058177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018800|Ga0193306_1050493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300018800|Ga0193306_1061458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300018800|Ga0193306_1075452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300018801|Ga0192824_1078826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300018801|Ga0192824_1090910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300018811|Ga0193183_1067968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300018812|Ga0192829_1072246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018812|Ga0192829_1072253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018821|Ga0193412_1055538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018823|Ga0193053_1050495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300018823|Ga0193053_1050498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300018823|Ga0193053_1050502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300018823|Ga0193053_1050642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300018823|Ga0193053_1071950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300018825|Ga0193048_1065267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300018830|Ga0193191_1055614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300018830|Ga0193191_1068128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300018831|Ga0192949_1076458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018831|Ga0192949_1083049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018832|Ga0194240_1006640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium850Open in IMG/M
3300018832|Ga0194240_1012135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium724Open in IMG/M
3300018832|Ga0194240_1012189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300018832|Ga0194240_1023490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300018838|Ga0193302_1057066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300018838|Ga0193302_1066175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300018838|Ga0193302_1066490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300018840|Ga0193200_1239994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300018842|Ga0193219_1047442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300018842|Ga0193219_1050393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300018846|Ga0193253_1101443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300018846|Ga0193253_1103190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300018846|Ga0193253_1104415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300018846|Ga0193253_1106041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300018846|Ga0193253_1109275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300018846|Ga0193253_1125675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300018846|Ga0193253_1138621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300018853|Ga0192958_1126740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300018861|Ga0193072_1080337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300018862|Ga0193308_1053087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300018862|Ga0193308_1054522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018864|Ga0193421_1087606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300018870|Ga0193533_1089678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018870|Ga0193533_1108607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300018872|Ga0193162_1085157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300018874|Ga0192977_1080647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018879|Ga0193027_1079128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018881|Ga0192908_10056205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018882|Ga0193471_1075187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300018885|Ga0193311_10041163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300018885|Ga0193311_10042552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300018888|Ga0193304_1088583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300018905|Ga0193028_1075481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300018905|Ga0193028_1112732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300018907|Ga0193548_10018850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300018907|Ga0193548_10019289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018913|Ga0192868_10049428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018922|Ga0193420_10076387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300018926|Ga0192989_10116900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300018926|Ga0192989_10121743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300018926|Ga0192989_10123760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018926|Ga0192989_10131440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300018926|Ga0192989_10132073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300018926|Ga0192989_10134105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018928|Ga0193260_10114535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300018928|Ga0193260_10132714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300018942|Ga0193426_10104760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300018945|Ga0193287_1097317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018964|Ga0193087_10189741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300018967|Ga0193178_10047268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018967|Ga0193178_10048380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300018967|Ga0193178_10050470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018967|Ga0193178_10051437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300018967|Ga0193178_10053379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018967|Ga0193178_10053878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018967|Ga0193178_10059846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018967|Ga0193178_10062769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300018967|Ga0193178_10075695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300018976|Ga0193254_10102770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300018976|Ga0193254_10109073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300018976|Ga0193254_10109669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300018976|Ga0193254_10111260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300018976|Ga0193254_10119326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300018977|Ga0193353_10218074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300018977|Ga0193353_10222487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018977|Ga0193353_10228266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300018977|Ga0193353_10235375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300018979|Ga0193540_10136205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018979|Ga0193540_10136211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300018979|Ga0193540_10181992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300018979|Ga0193540_10182896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018979|Ga0193540_10199632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300018980|Ga0192961_10162123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018980|Ga0192961_10224299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300018981|Ga0192968_10125846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018982|Ga0192947_10181396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300018982|Ga0192947_10181400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300018982|Ga0192947_10181402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300018982|Ga0192947_10201244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018982|Ga0192947_10202087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300018982|Ga0192947_10203703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018982|Ga0192947_10219925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300018982|Ga0192947_10242693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018986|Ga0193554_10232723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300018989|Ga0193030_10158952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300018989|Ga0193030_10172674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300018989|Ga0193030_10172777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300018989|Ga0193030_10184266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300018989|Ga0193030_10186408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300018989|Ga0193030_10191264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018989|Ga0193030_10194138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300018989|Ga0193030_10194160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300018989|Ga0193030_10197068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300018989|Ga0193030_10197829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300018989|Ga0193030_10198805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300018989|Ga0193030_10199972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018989|Ga0193030_10205966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300018989|Ga0193030_10207240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018989|Ga0193030_10209309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018989|Ga0193030_10212096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018989|Ga0193030_10230229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018989|Ga0193030_10233592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300018989|Ga0193030_10247801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300018989|Ga0193030_10272025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300018989|Ga0193030_10279029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300018989|Ga0193030_10284719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300018989|Ga0193030_10292119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300018989|Ga0193030_10297208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300018997|Ga0193257_10205543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300019001|Ga0193034_10077268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300019001|Ga0193034_10089114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300019001|Ga0193034_10112815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300019001|Ga0193034_10115473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300019001|Ga0193034_10150217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300019001|Ga0193034_10160385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300019001|Ga0193034_10169267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300019010|Ga0193044_10196883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300019017|Ga0193569_10289346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300019017|Ga0193569_10289349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300019017|Ga0193569_10301010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300019017|Ga0193569_10416812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019020|Ga0193538_10212589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300019022|Ga0192951_10221808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300019022|Ga0192951_10234398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300019022|Ga0192951_10305271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019022|Ga0192951_10305409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300019022|Ga0192951_10396880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300019025|Ga0193545_10081045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300019027|Ga0192909_10119953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300019027|Ga0192909_10157631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300019027|Ga0192909_10296658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300019031|Ga0193516_10246461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300019031|Ga0193516_10300494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019032|Ga0192869_10291083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300019032|Ga0192869_10388584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300019032|Ga0192869_10389617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300019032|Ga0192869_10522238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300019033|Ga0193037_10317087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300019033|Ga0193037_10333426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300019036|Ga0192945_10151474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300019036|Ga0192945_10167824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300019036|Ga0192945_10188337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300019036|Ga0192945_10194749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300019036|Ga0192945_10197317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019036|Ga0192945_10223919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019036|Ga0192945_10227282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300019036|Ga0192945_10281658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300019036|Ga0192945_10281661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300019039|Ga0193123_10263242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300019039|Ga0193123_10360910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300019039|Ga0193123_10434262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300019040|Ga0192857_10312969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019045|Ga0193336_10341390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300019045|Ga0193336_10373412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300019045|Ga0193336_10391885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300019045|Ga0193336_10465957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019045|Ga0193336_10473827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019045|Ga0193336_10508873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300019045|Ga0193336_10522326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300019045|Ga0193336_10591350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300019045|Ga0193336_10641986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300019045|Ga0193336_10658177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300019045|Ga0193336_10675168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019047|Ga0193549_10034606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300019047|Ga0193549_10037530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300019050|Ga0192966_10214680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300019051|Ga0192826_10137594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300019051|Ga0192826_10224419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300019051|Ga0192826_10226197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300019051|Ga0192826_10226863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300019051|Ga0192826_10227972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300019051|Ga0192826_10239180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300019051|Ga0192826_10247545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300019051|Ga0192826_10250848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300019051|Ga0192826_10250877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300019051|Ga0192826_10266723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300019051|Ga0192826_10268740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300019051|Ga0192826_10273893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300019051|Ga0192826_10278563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300019051|Ga0192826_10290556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300019051|Ga0192826_10291432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019051|Ga0192826_10295613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019051|Ga0192826_10326383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019051|Ga0192826_10335310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300019051|Ga0192826_10342571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300019051|Ga0192826_10352084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019051|Ga0192826_10362037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300019051|Ga0192826_10366712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300019055|Ga0193208_10594147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300019084|Ga0193051_111783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019095|Ga0188866_1023060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300019095|Ga0188866_1025901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300019095|Ga0188866_1030761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300019095|Ga0188866_1033243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019095|Ga0188866_1035785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300019097|Ga0193153_1022237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300019097|Ga0193153_1026667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300019099|Ga0193102_1024641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300019102|Ga0194243_1003880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300019102|Ga0194243_1005046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300019102|Ga0194243_1007313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300019103|Ga0192946_1046125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300019103|Ga0192946_1050557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300019108|Ga0192972_1047490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium832Open in IMG/M
3300019111|Ga0193541_1059483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300019116|Ga0193243_1029727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300019116|Ga0193243_1038401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300019116|Ga0193243_1043793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300019117|Ga0193054_1025461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum867Open in IMG/M
3300019117|Ga0193054_1039144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300019117|Ga0193054_1040994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300019117|Ga0193054_1043423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300019117|Ga0193054_1044737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300019117|Ga0193054_1074762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300019118|Ga0193157_1020525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300019118|Ga0193157_1021730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300019118|Ga0193157_1025603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300019118|Ga0193157_1029041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300019118|Ga0193157_1034071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300019120|Ga0193256_1068944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300019123|Ga0192980_1061319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300019125|Ga0193104_1032737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300019125|Ga0193104_1046703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300019129|Ga0193436_1037953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300019129|Ga0193436_1041832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300019129|Ga0193436_1044258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300019136|Ga0193112_1133138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300019139|Ga0193047_1085730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300019149|Ga0188870_10111557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300019149|Ga0188870_10115206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300019149|Ga0188870_10135998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300019150|Ga0194244_10044053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019150|Ga0194244_10044056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019150|Ga0194244_10044057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019150|Ga0194244_10046305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300019150|Ga0194244_10061804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300019150|Ga0194244_10081011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300019282|Ga0182075_1134040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300020014|Ga0182044_1159068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300020175|Ga0206124_10222561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300020422|Ga0211702_10088978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium867Open in IMG/M
3300021348|Ga0206695_1113271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300021350|Ga0206692_1483705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300021350|Ga0206692_1627769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300021350|Ga0206692_1732495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300021353|Ga0206693_1325904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300021353|Ga0206693_1613720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300021353|Ga0206693_1769012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300021373|Ga0213865_10278108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum790Open in IMG/M
3300021868|Ga0063111_114157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300021872|Ga0063132_106913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300021889|Ga0063089_1017288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300021889|Ga0063089_1043246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300021889|Ga0063089_1075968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300021891|Ga0063093_1033552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300021895|Ga0063120_1060238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300021896|Ga0063136_1001655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300021896|Ga0063136_1012782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300021899|Ga0063144_1058126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021908|Ga0063135_1074925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300021912|Ga0063133_1011582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300021912|Ga0063133_1012544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300021912|Ga0063133_1020726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300021912|Ga0063133_1041469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300021934|Ga0063139_1014153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300021935|Ga0063138_1087216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300021941|Ga0063102_1025222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300021941|Ga0063102_1031287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300021950|Ga0063101_1007286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300021950|Ga0063101_1065442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300023554|Ga0228692_102685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300023679|Ga0232113_1023840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300023683|Ga0228681_1034536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300023683|Ga0228681_1040719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300023696|Ga0228687_1033716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300023698|Ga0228682_1040670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300023698|Ga0228682_1041834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300023698|Ga0228682_1044970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300023698|Ga0228682_1051138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300023698|Ga0228682_1058830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300023701|Ga0228685_1055218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300023704|Ga0228684_1056869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300025138|Ga0209634_1228470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300025680|Ga0209306_1089829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium925Open in IMG/M
3300025680|Ga0209306_1095818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium887Open in IMG/M
3300025690|Ga0209505_1086562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium919Open in IMG/M
3300025704|Ga0209602_1121144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum886Open in IMG/M
3300025712|Ga0209305_1191495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300025881|Ga0209309_10443300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300026403|Ga0247557_1018757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300026403|Ga0247557_1038287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300026420|Ga0247581_1062020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300026420|Ga0247581_1063914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300026420|Ga0247581_1079362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300026434|Ga0247591_1078973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300026434|Ga0247591_1087086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300026447|Ga0247607_1071610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300026447|Ga0247607_1078448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300026447|Ga0247607_1083748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300026447|Ga0247607_1089025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300026447|Ga0247607_1090568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300026448|Ga0247594_1053186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300026448|Ga0247594_1057879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300026448|Ga0247594_1059704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300026448|Ga0247594_1067162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300026448|Ga0247594_1076406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300026448|Ga0247594_1100142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300026449|Ga0247593_1109841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300026458|Ga0247578_1116568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300026462|Ga0247568_1120272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300026465|Ga0247588_1092708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300026465|Ga0247588_1093210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300026466|Ga0247598_1118556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300026466|Ga0247598_1138926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300026468|Ga0247603_1089453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300026468|Ga0247603_1093590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300026468|Ga0247603_1121913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300026470|Ga0247599_1111066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300026495|Ga0247571_1090015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300026495|Ga0247571_1091620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300026495|Ga0247571_1117683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300026495|Ga0247571_1143144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300026500|Ga0247592_1123819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300026500|Ga0247592_1142948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300026500|Ga0247592_1146676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300026503|Ga0247605_1123233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300026503|Ga0247605_1133627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300026504|Ga0247587_1126685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300026504|Ga0247587_1127173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300026504|Ga0247587_1131629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300026504|Ga0247587_1181165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300026513|Ga0247590_1150492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300026513|Ga0247590_1176843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300027687|Ga0209710_1150529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum846Open in IMG/M
3300027780|Ga0209502_10232954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium828Open in IMG/M
3300027801|Ga0209091_10236646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium893Open in IMG/M
3300027833|Ga0209092_10285914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300027833|Ga0209092_10499532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300027833|Ga0209092_10622492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300028076|Ga0247562_1030989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300028102|Ga0247586_1077734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300028106|Ga0247596_1116824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300028106|Ga0247596_1116913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300028106|Ga0247596_1117981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300028109|Ga0247582_1126166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300028109|Ga0247582_1141880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300028109|Ga0247582_1152947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300028110|Ga0247584_1149091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300028119|Ga0247561_114606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300028134|Ga0256411_1206891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300028137|Ga0256412_1244160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300028137|Ga0256412_1249156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300028137|Ga0256412_1252211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300028137|Ga0256412_1263529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300028137|Ga0256412_1283531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300028137|Ga0256412_1283595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300028137|Ga0256412_1283927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300028137|Ga0256412_1285153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300028137|Ga0256412_1285959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300028233|Ga0256417_1123492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300028233|Ga0256417_1167051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300028233|Ga0256417_1177029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300028282|Ga0256413_1244691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300028282|Ga0256413_1245922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300028282|Ga0256413_1268871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300028282|Ga0256413_1271456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300028282|Ga0256413_1284152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300028282|Ga0256413_1290505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300028282|Ga0256413_1310139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300028282|Ga0256413_1345141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300028290|Ga0247572_1120183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300028290|Ga0247572_1173705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300028330|Ga0247601_1041194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300028334|Ga0247597_1038841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300028334|Ga0247597_1051651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300028575|Ga0304731_10665657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300028575|Ga0304731_10705116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300028575|Ga0304731_10846266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300028575|Ga0304731_10930285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300028575|Ga0304731_11613167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300028575|Ga0304731_11623331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300028672|Ga0257128_1084976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300028672|Ga0257128_1107007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300030670|Ga0307401_10495777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300030671|Ga0307403_10555831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300030671|Ga0307403_10596565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300030699|Ga0307398_10629649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300030709|Ga0307400_10771408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300030715|Ga0308127_1032791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300030720|Ga0308139_1057955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300030721|Ga0308133_1052023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300030721|Ga0308133_1055051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030780|Ga0073988_12282656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300030780|Ga0073988_12325287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300030780|Ga0073988_12346827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300030781|Ga0073982_10006626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300030786|Ga0073966_11673862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300030856|Ga0073990_10005224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300030856|Ga0073990_10009840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300030856|Ga0073990_10014566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300030856|Ga0073990_10017782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300030856|Ga0073990_11979743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300030857|Ga0073981_11647084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300030857|Ga0073981_11700086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300030857|Ga0073981_11700208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300030857|Ga0073981_11717161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300030857|Ga0073981_11717232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300030869|Ga0151492_1062367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum836Open in IMG/M
3300030952|Ga0073938_12063879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300030957|Ga0073976_11612448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300031004|Ga0073984_10002033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300031004|Ga0073984_11290131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300031032|Ga0073980_11374451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300031037|Ga0073979_12454577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300031038|Ga0073986_10016964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300031038|Ga0073986_11991614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300031038|Ga0073986_12041667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300031056|Ga0138346_10338815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300031062|Ga0073989_13522046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300031062|Ga0073989_13590477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300031062|Ga0073989_13596476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300031062|Ga0073989_13598221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300031113|Ga0138347_11320851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300031121|Ga0138345_10364643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300031522|Ga0307388_10896259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300031540|Ga0308143_123896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300031542|Ga0308149_1038279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300031557|Ga0308148_1044393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300031579|Ga0308134_1105397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300031579|Ga0308134_1108239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300031579|Ga0308134_1111079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300031579|Ga0308134_1127144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300031579|Ga0308134_1147201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300031579|Ga0308134_1164358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300031594|Ga0302131_1290070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300031622|Ga0302126_10223937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300031674|Ga0307393_1161293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300031710|Ga0307386_10796199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300031717|Ga0307396_10454538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300031725|Ga0307381_10252818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300031725|Ga0307381_10404325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300031729|Ga0307391_10600669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300031729|Ga0307391_10924277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300031734|Ga0307397_10446622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300031739|Ga0307383_10405036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300031739|Ga0307383_10552541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300031742|Ga0307395_10557884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031743|Ga0307382_10365483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300031750|Ga0307389_10962777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300032047|Ga0315330_10521634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300032470|Ga0314670_10680606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300032481|Ga0314668_10443971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300032517|Ga0314688_10637842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300032518|Ga0314689_10520676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300032518|Ga0314689_10552495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300032518|Ga0314689_10647300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032519|Ga0314676_10489456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300032519|Ga0314676_10737858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300032521|Ga0314680_10741719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300032521|Ga0314680_10764036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300032521|Ga0314680_10891734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300032522|Ga0314677_10433416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300032540|Ga0314682_10581423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300032617|Ga0314683_10473228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300032617|Ga0314683_10698001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300032617|Ga0314683_10815400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300032650|Ga0314673_10450238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300032650|Ga0314673_10580923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300032651|Ga0314685_10657921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300032666|Ga0314678_10433836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300032666|Ga0314678_10461077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300032711|Ga0314681_10526098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300032711|Ga0314681_10534043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300032713|Ga0314690_10444547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300032723|Ga0314703_10374957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300032730|Ga0314699_10478409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300032730|Ga0314699_10479092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300032730|Ga0314699_10487837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300032732|Ga0314711_10687776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300032733|Ga0314714_10685904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300032733|Ga0314714_10774601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300032734|Ga0314706_10435028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300032742|Ga0314710_10309032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300032744|Ga0314705_10559830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300032747|Ga0314712_10417703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300032748|Ga0314713_10426615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300032750|Ga0314708_10631837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300032751|Ga0314694_10501773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300032752|Ga0314700_10481647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300032752|Ga0314700_10710488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300033572|Ga0307390_10795620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine49.12%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.86%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.19%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.30%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.49%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.22%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.08%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.81%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.81%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.27%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.27%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.14%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.14%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.14%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.14%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.14%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.14%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300003303Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011312Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018556Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001478 (ERX1789635-ERR1719475)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018778Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002019 (ERX1789532-ERR1719207)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018821Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789489-ERR1719145)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018840Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000013 (ERX1782199-ERR1712136)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018907Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399744-ERR1328122)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018945Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001608 (ERX1789687-ERR1719388)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019047Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399746-ERR1328125)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021868Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021891Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021895Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023554Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 71R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028076Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030869Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030957Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1020167813300001354Pelagic MarineMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGE
Ga0006246J48908_107631213300003303SeawaterEFPCVLEKKPVYKAWDSVKDGAADGKYERLPVSHFSADSDDIFMRSMVSKYAYEKRTPIEMLEDGSKIGGEPTGSFWLSKTDMTYAAKEVLKTHKGLSGEKLSSYLDTYFDRAWENFDPNGDGSVEVIKAPMFMRFLASDQGMGLGESG*
Ga0008458J53046_10317213300003677SeawaterMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075502_154720913300006357AqueousMKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075495_156479213300006399AqueousRGQNSFYRVCAGVCDVGVCGRRVRYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075506_179757113300006401AqueousQMKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075514_170388313300006403AqueousKQMKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075496_143259013300006419AqueousAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0075484_148646613300006602AqueousKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNQTGSISVYRSAEFMRFLASDQYMSLG*
Ga0031676_100789813300006728Deep OceanATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG*
Ga0105749_116321913300007864Estuary WaterAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQYMSLGESG*
Ga0105742_102321113300007957Estuary WaterKPEATDPYNAWDSIKDGAEDGKYERQVTAHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0105743_101663013300007958Estuary WaterQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFIRFICSDQYMSLGESG*
Ga0103951_1071319313300008832MarineTWDYNAWDSIKDGAKEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKEILDDGEIIGGEPTGKFWMTQKTTLAAAKEVLATHKGLTGDAAAAYLDTYFDKAWENFDVNGAGQIEVIVTPQFMRFLCSDQRMSLGESG*
Ga0103883_106091713300008835Surface Ocean WaterWESVKDGAEDGKYERIVTPHFSSDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALNAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQSLSLGESG*
Ga0103741_107843013300008938Ice Edge, Mcmurdo Sound, AntarcticaMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAGAALSSYLDTYFEKSWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG*
Ga0104261_100413733300008956Ocean WaterDGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG*
Ga0104259_102310113300008958Ocean WaterAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0104259_102875313300008958Ocean WaterMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA*
Ga0104258_107608013300008993Ocean WaterFALIALLSVVAAKPEATDPYNAWDSIKDGAEDGKYERQVTAHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0104258_109881213300008993Ocean WaterAIAIVCLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLAAAKEVLNTHKGLSGPALGSYMDTYFDKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0103706_1010548213300009022Ocean WaterKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAVDGKYERVITPHFSGDDDDIFMRSMIKTYAHEQRTPIEELDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG*
Ga0103706_1018787913300009022Ocean WaterLGLLCVKYLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG*
Ga0103707_1008429513300009025Ocean WaterYTRMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSSDSDDIFMRSMISKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG*
Ga0103707_1019220623300009025Ocean WaterMHEKMTGKGFDKPAPPYNAYESVKDGAPDGKYERVIHTHFAGDGDDIFMRSMITTYAVEKENKDGSPTGVFMLTKSGAYAAAQEVLATHKGLHGAGLKSYLDTYFDKAWGHFDVMKTGSIEVQKAPQFMRFLASDQRMSLGESS
Ga0115566_1083933413300009071Pelagic MarinePKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNK
Ga0115552_116436513300009077Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115552_117585913300009077Pelagic MarinePKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0114995_1031339523300009172MarineMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTKAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA*
Ga0115551_127407413300009193Pelagic MarineMLRRHFIINKKNNQKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115551_144664513300009193Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVE
Ga0103872_103521413300009263Surface Ocean WaterFVIACLLGLSAAETGKPEPTPPYNAWESVKGGAEDGKYERIITPNFSGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQFMRFLASDQNLSLGESG*
Ga0103872_104155513300009263Surface Ocean WaterLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAADGRYERVITPHFSSDKDDLFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0103872_105030213300009263Surface Ocean WaterFAALFAIAAAKVGKPEPTAPYNAWESVKDGAEDGKYERIVTPHFSSDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALNAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQSLSLGESG*
Ga0103872_105997313300009263Surface Ocean WaterKDGAADNKYERLPIAHFSADSDDIFMRSMVKKYAFEKRTPIEELEDGTKIGGEPTGSFWLTKKDMSLAAKEVLATHKGLTGDKLASYMDTYFDRAWENFDPNGDGEIEVIKCPMFMRFLASDQGMSLGENGEDSGEIKAFNDLRKKMAEK*
Ga0103872_106447513300009263Surface Ocean WaterSVKDGADDGKYERVIPANFKGDKDDLFMRSMIKKYAVEERTDTEELEDGTKIGGEPTGKFWMNQVTSLAAAKEVLATHKGLKGDMLSAYLDTYFAKAWAHFDVNQTGEIEVIKMPQFMRFLASDQYMQLGESG*
Ga0103873_103405613300009265Surface Ocean WaterGVIACLLGLSAAGKPEPTPPYNAWESVKDGAADGKYERIITPHFSGDADDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQFMRFLASDQNLSLGESG*
Ga0103873_106481013300009265Surface Ocean WaterIYMRTFAIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAADGRYERVITPHFSSDKDDLFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0103873_107262713300009265Surface Ocean WaterHKNSNLYGRQMRAFVIACLLGLSAAETGKPEPTPPYNAWESVKGGAEDGKYERIITPNFSGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQFMRFLASDQNLSLGESG*
Ga0103873_107873113300009265Surface Ocean WaterLSPLKFAIACLLGMAAAVSLSKPEPTAPYQAWESVKDGAEDGKYERVIPANFKGDKDDLFMRSMIKKYAVEERTDTEELEDGTKIGGEPTGKFWMNQVTSLAAAKEVLATHKGLKGDMLSAYLDTYFAKAWAHFDVNQTGEIEVIKMPQFMRFLASDQYMQLGESG*
Ga0103873_109433413300009265Surface Ocean WaterVIAALFALTAAKVGKPEPTAPYNAWESVKDGAEDGKYERIVTPHFSSDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALNAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQSLSLGESG*
Ga0103827_100858823300009357River WaterALLGLAAAVQKPEATPPYNAWDSVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALNAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQFMSLGESG*
Ga0115008_1044543913300009436MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG*
Ga0115556_123054013300009437Pelagic MarinePKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115553_115985113300009445Pelagic MarineMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115570_1019430713300009496Pelagic MarineMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDATKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115569_1037466613300009497Pelagic MarineMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTM
Ga0115568_1041905213300009498Pelagic MarinePKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLG
Ga0115567_1034475513300009508Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLYGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115004_1031666013300009526MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG*
Ga0115004_1034455213300009526MarinePKPQNPAHMIKKYYYDRLLKKYRRNNRIIIIKKLQMKYFALIALLSAVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLGSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG*
Ga0115099_1060777113300009543MarineQMKYFALLALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115099_1068358913300009543MarineKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG*
Ga0115099_1071959413300009543MarineSVKDGAEDGKYERVVTPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG*
Ga0115099_1072002823300009543MarineSVKDGAEDGKYERVVTPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALASYMDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVASDQNMGLGESG*
Ga0115099_1091293013300009543MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG*
Ga0115099_1104370113300009543MarineYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115101_165483913300009592MarineQKMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALASYMDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVASDQNMGLGESG*
Ga0115101_184868513300009592MarineLQMKYFALLALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115103_102786113300009599MarineKYFALLALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115103_107515413300009599MarineKKMRAIAIVCLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLAAAKEVLNTHKGLSGPALGSYMDTYFDKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115103_110314413300009599MarineKYFALIALLSVVAAKPEATDPYNAWDSIKDGAEDGKYERQVTAHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115103_138126113300009599MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNEGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115103_143024113300009599MarineAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTSHFSADDDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG*
Ga0115103_144817213300009599MarineMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALASYMDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVASDQNMGLGESG*
Ga0115102_1049006913300009606MarineVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG*
Ga0115102_1060007813300009606MarineMKYFALIALLSVVAAKPEATDPYNAWDSIKDGAEDGKYERQVTAHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115102_1062990113300009606MarineLFAACVAAKEDTKPTAPYGAWESVKDGAEDGKYERIITPHFSGDSDDIFMRSMIKKYAVEERTDTTTLKDGTEIGGEPTGKFWMNQATALAASKEVLNTHKGLAGEALSAYLDTYFAKAWAHFDVNQAGEVEVTKMPQFMRFLSSDQNLSLGESG*
Ga0115102_1081474413300009606MarineKQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115100_1000975713300009608MarineQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEALASYIDTYYDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0115100_1032951313300009608MarineMKYFALLALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG*
Ga0115100_1067236713300009608MarineMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTSHFSADDDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG*
Ga0115100_1086383013300009608MarineKKIIKKMRAIAIVCLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLAAAKEVLNTHKGLSGPALGSYMDTYFDKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0115100_1086607313300009608MarineAFTIACLLGLSAAVKLASSFPAGPGTPVEQDPFNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKVMADDGQISGGEPTGIFWITPKEAKWASNEVMKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQ*
Ga0115100_1088093513300009608MarineISTQMRAFAIVALFAACVAAKEDTVKTAPYGAWESVKDGAEDGKYERIITPHFSGDSDDIFMRSMIKKYAVEERTDTTTLKDGTEIGGEPTGKFWMNQATTLAASKEVLNTHKGLAGEALSAYLDTYFAKAWAHFDVNQSAEVEVTKMPQFMRFLASDQNLSLGESG*
Ga0115100_1105051013300009608MarineLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG*
Ga0115100_1115332613300009608MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAGDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG*
Ga0115104_1009746413300009677MarineKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG*
Ga0115104_1028981913300009677MarineKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAAAKEVLGTHKGLGGDALASYVDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMSLGESG*
Ga0115104_1045239413300009677MarineAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIGKYAVELRTDTETLDDGTTVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG*
Ga0115105_1040573813300009679MarineAIVIACLLGLTVAIKKVEPTAPYNAWESVKDGAEDGKYERVITAHFSGDADDIFMRSMIKKYAQEERTDTETLDDGSKIGGEPTGKFWMTQGTALAAAKEVMNTHKGLAGDALSAYLDTYFAKAWAHFDVNQGGQIEVIKMPQFMRFLASDQYMSLQ*
Ga0115105_1079760513300009679MarineRTIAVACLLGLASAVQKPEPTAPYNAWESVKDGAEDGKYERVVTPHFSADSDDIFMRSMIKKYAVEERTDTEELDDGTKIGGEPTGKFNMTKANALGAAKEVLNTHKGLAGDALAAYIDTYFEKAWAHFDVNQTGKIEVIKMPQFCRFIASDQSMSLGESG*
Ga0115105_1105385113300009679MarineRTIAIACLLGLAAASTGKPEPTPPYNAWESVKDGAVDGKYERLPVPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGTKVGGEPTGSFWLTKKDMMYAAKEVLGTHKGLTGDKLSSYLDTYFDRAWENFDPNGDGQVEVIKCPMFMRFLASDQTIDLGESG*
Ga0115000_1038691913300009705MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVAGGKDEGKYERKVPTHFGADNDDIFMRSMLTKYALEEKTPVKELDDGSKVGGEPTGKFWLDKEKARMAASEVLSTHKGLGGPALSSYLETYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG*
Ga0123373_10115913300009732MarineEKKPKYNAWESIKDGAADNKYERLPIAHFSADSDDIFMRSMVKKYAFEKRTPIEELEDGTKIGGEPTGSFWLAKKDMSYAAKEVLATHKGLSGDKLASYMDTYFDRAWENFDPNGDGEIEVIKAPMFMRFLASDQGMSLGENGEDEGEIKAFNDLRKKMADK*
Ga0123373_15555913300009732MarineTFAIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0123361_107643413300009741MarineFAIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0115001_1051719013300009785MarinePEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG*
Ga0115001_1058358213300009785MarinePTYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGVFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDGSMQIGESG*
Ga0129342_121605213300010299Freshwater To Marine Saline GradientPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0138316_1004571613300010981MarineWESVKDGAEDGKYERVVTPNFSGDADDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVTKMPQLMRFLASDQNLSLGESG*
Ga0138316_1031889213300010981MarineMRTIAIACLLGLTVAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFAGDADDIFMRSMIKKYAQEERTDHEELDDGTKIGGEPTGKFIMTKGTSLAAAKEVLNTHKGLSGDALSAYLDTYFDKAWAHFDVNQGGSLDVIKMPQFMRFLASDQSMSLGESG*
Ga0138316_1045336013300010981MarineEQMRTIAIACLLGLAVAIKKPEPTPPYNAWESVKDGAEDGHYERVITSHFSGDSDDIFMRSMIKKYAVEERTDSDELDDGTKIGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFIASDQNMQLGESG*
Ga0138316_1076408613300010981MarineMKAIAIAALLGLTVAIQKTEPTAPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQGTSMAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQNMGLGESG*
Ga0138316_1082182513300010981MarineMKAAVIALFLGLAVAIKSQDSEKTPPYNAWESVKDGAADGKYERVATAHFSGDGDDIFMRSMITKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG*
Ga0138316_1114165113300010981MarineAASVEIKGDPTPPYNAWESVKDGAEDGKYERVTTPHFSADSDDIFMRSMINKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLNAAKEVLATHKGLGGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMDLGVSG*
Ga0138326_1012662713300010985MarineIMRAFVIAALLGLATCIRDSEKTPPYNAWESVKDGKEDGKYERVTTAHFSGDSDDIFMRSMINKYAQETRTDTETLDDGTKLGGEPTGKFIMTQSTALGAAKEVLATHKGLSGDALSAYLDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG*
Ga0138326_1014359713300010985MarineMKAAVIALFLGLAVAIKSTDSEKTAPYNAWESVKDGKEDGKYERQVTAHFSGDSDDIFMRSMIKNYAVELRTDTETLDDGTKIGGEPTGKFMMTEANALGAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQGGKIDVIKMPQFMRFLASDQSLSLGESG*
Ga0138326_1024167413300010985MarinePYNAWESVKDGAEDGKYERVITPNFSADSDDIFMRSMIKKYAQEERTDTETLDDGTKLGGEPTGKFWMTQKTTLAAAKEVLNTHKGLAGDALAAYLDTYFAKAWAHFDVNQTGEVEVIKMPQLMRFLCSDQYMTLGESG*
Ga0138326_1038080013300010985MarineMKAAVIALFLGLAVAIKSQDSEKTPPYNAWESVKDGAADGKYERVATAHFSGDGDDIFMRSMITKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALGAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG*
Ga0138326_1114910213300010985MarineMRAIAIACLLGLAAATKIQKTEATAPYNAWESVKDGAEDGHYERVITSHFSGDSDDIFMRSMIKKYAVEERTDTDELDDGTKVGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFIASDQNMQLGESG*
Ga0138326_1148339313300010985MarineMKAIAIAALLGLTVAIQKTEPTAPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFLMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFGKAWAHFDVNQTGEVEVIKMPQFMRFLASDQNLSLGESG*
Ga0138326_1159893113300010985MarineMKAIAVACLLGLTVAIQKPVATPPYNAWESVKDGAEDGKYERVVTPHFSADSDDIFMRSMIKKYAIEERTDTEELDDGTKIGGEPTGKFNMTKANALAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQTGKIEVIKMPQFCRFIASDQSMSLGESG*
Ga0138324_1041318513300010987MarineMRTIAIACLLGLTVAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFAGDADDIFMRSMIKKYAQEERTDHEELDDGTKIGGEPTGKFIMTKGTSLAAAKEVLNTHKGLSGDALSAYLDTYFDKAWAHFDVNQGGSLDVIKMPQFMRFLASDQWMSLKESG*
Ga0138324_1044044113300010987MarineMKAAVIALFLGLAVAIKSQDSEKTPPYNAWESVKDGAADGKYERVATAHFSGDGDDIFMRSMITKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALGAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG*
Ga0138324_1050659413300010987MarineKAIVIAALLGLTVAINMKGDPTAPYNAWESVEDGAADGKYERVITPHFSGDGDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLSAYMDTYFAKAWAHFDVNQKGQIEVIKMPQFMRFLCSDQRMQLGESG*
Ga0138324_1051649613300010987MarineKFTLAIAAFLSLSAAMKLEKDYFQPWEHVADGKEDGKYERAIPAHFSSDGDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLSAYMDTYFAKAWAHFDVNQKGQIEVIKMPQFMRFLCSDQRMQLGESG*
Ga0138324_1060633013300010987MarineTIAIACLLGLAASVEIKGDPTPPYNAWESVKDGAEDGKYERVTTPHFSADSDDIFMRSMINKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLNAAKEVLATHKGLGGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMDLGVSG*
Ga0138324_1066256113300010987MarineFMKFLAIAALLGLAVAVQKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLQ*
Ga0138349_112687113300011312Deep OceanFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG*
Ga0129329_106690513300012470AqueousMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGIFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0129329_107069613300012470AqueousKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG*
Ga0129328_110259013300012472AqueousVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGIFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0129328_111212113300012472AqueousLLDFACLLGGRRTITKTKKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0129347_127753113300012504AqueousVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG*
Ga0129349_108015213300012518AqueousKSIVFAALLGLTFGIQKTEKTAPYQAWESVKDGAEDGKYERVVTANFKGDDDDIFMRSMIKKYAIEKRTDTEILDDGTKIGGEPTGKFMMTQATALAASKEVLNTHKGLSGDLLSAYLDTYFGKAWGHFDVNQTGEIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129349_125625713300012518AqueousKFLAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG*
Ga0129349_132922913300012518AqueousFILTMRTIAFAALLGLAATASVRAPEPTPPYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGSFWMTQANTLAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKVEVIKMPQFMRFLCSDQSMQLGESG*
Ga0129349_136477413300012518AqueousRTFAIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0129349_146126613300012518AqueousKYERVVTANFASDSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129344_123961213300012520AqueousKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG*
Ga0129344_135236813300012520AqueousIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0129350_110968013300012523AqueousMKFLAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG*
Ga0129350_117703413300012523AqueousILTMRTIAFAALLGLAATASVRAPEPTPPYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKIGGEPTGSFWMTQANTLAAAKEVLNTHKGLSGDALAAYIDTYFAKAWAHFDVNQTGKIEVIKSPQFMRFLCSDQYMQLGESG*
Ga0129350_134676313300012523AqueousEDGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129350_147783013300012523AqueousDSESDDETHVGLSAEDTKKTPPYNAWESIKDGAVEGKYERVITPNFSADSDDLFMRSMITKYAQEARTDTETLDDGSTIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWENFDVNGTGSVEVIKSPQFMRFLASDQTMQLGE*
Ga0129331_107434813300012524AqueousKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVNSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGIFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0129331_141483713300012524AqueousQKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0129353_132875413300012525AqueousTIAFAALLGLAASIRAPEPTPPYNAWESVKDGAKDGKYERVVTPHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGSFWMTQANTLAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKVEVIKMPQFMRFLCSDQSMQLGESG*
Ga0129353_196920913300012525AqueousMKYAVIAALVAVVAAKPEATPPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0129352_1029334113300012528AqueousFILTMRTIAFAALLGLAATASVRAPEPTPPYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKIGGEPTGSFWMTQANTLAAAKEVLNTHKGLSGDALAAYIDTYFAKAWAHFDVNQTGKIEVIKSPQFMRFLCSDQYMQLGESG*
Ga0129352_1103541013300012528AqueousHAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG*
Ga0163111_1122440613300012954Surface SeawaterTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG*
Ga0129341_118940713300012966AqueousMRTFAIACLLGLAVAVKLEKPSGKPAAPGTPYEQAPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG*
Ga0129332_101255813300012969AqueousIIKKMRAIAIACLLGRGGAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG*
Ga0129332_131949413300012969AqueousQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGIFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG*
Ga0182045_113581513300016726Salt MarshAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG
Ga0182049_112728713300016736Salt MarshQMKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG
Ga0182047_118907913300016737Salt MarshKYAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG
Ga0182091_149451313300016766Salt MarshAVIAALVAVVAAKPEATAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG
Ga0180120_1022288213300017697Freshwater To Marine Saline GradientPKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGIFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0181393_108023823300017748SeawaterMKTIAIAALLGLVACTKLGDPEKTPPYNAWESVKDGAEDGKYERVVTSNFKGDDDDIFMRSMIKKYAVEMRTDSETLDDGTKIGGEPTGKFMMTQSTSLAAAKEVLGTHKGLSGDALSAYLDTYFSKAWAHFDVMQDGKIDVIKMPQFMRFLASDQYMSLGESG
Ga0181392_122308313300017749SeawaterMKTFAIAALIGLVACTKLNGPTPAKNAWESVAGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTDTLDDGTKVGGEPTGKFWMTQANALAAAKEVLGTHKGLAGDALSAYIDTYFAKAWAHFDVNQSGKIEVIKMPQFCR
Ga0187217_113473923300017770SeawaterMKTFAIAALIGLVACTKLNGPTPAKNAWESVAGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTDTLDDGTKVGGEPTGKFWMTQANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMQLGESG
Ga0181425_111151213300017771SeawaterMRTIAFAALLGLAATASIKGDPTPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMISKYAVEARTDTETLDDGTKVGGEPTGSFWMTQANTLAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKVEVIKMPQFMRFLCSDQSMQLGESG
Ga0181430_114928213300017772SeawaterMRTFAIAALIGLAACHKLEGTTPPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFLASDQYMQLVESG
Ga0181379_119419313300017783SeawaterEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0192960_10420913300018515MarineMKFFAIAALLGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192942_10511813300018556MarineAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193060_101410313300018596MarineTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATCLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193182_101331823300018602MarineMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192842_102537013300018625MarineMRTIAIACLLGLAAAVQKTEKTPPYNAWESVKDGAEDGKYERVITPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0193355_101292413300018628MarineMGIIIKIKQQMRTIAIAALLGLAAASTKPEATAPYNAWESVKDGAEDGKYERVVTPNFSADSDDIFMRSMIKKYAVEERTDTEELDDGTKIGGEPTGKFNMTQANASAASKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193355_101448823300018628MarineMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193355_102242313300018628MarineSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATCLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMTLI
Ga0192969_103892313300018649MarineMKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0192969_105325513300018649MarineYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0193122_105791513300018661MarineWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQGTTMAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMSLGESG
Ga0193571_101690223300018671MarineAVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193166_101991013300018674MarineTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0192944_103334213300018692MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192944_103334323300018692MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAASKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192944_103767513300018692MarineMKFFAIAALLGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192944_103851313300018692MarineTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESGXATRKXNEQNGKDFLKLL
Ga0192944_103915313300018692MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0192944_106136813300018692MarineTWGILIINNNLEMRTIAIACLLGLVASSKLRGDPTPPYNAWDSVKGGTDDGKYERVVTPHFSADTDDIFMRSMITKYAIEERTDTDTLDDGRKVGGEPTGKFWMTQATTLGAAKEVLSTHKGLKGDALDAYLDTYFNKAWAHFDVNESGKVEVIKMPQYMRFLASDQFMSLGES
Ga0193405_102752613300018701MarineMKYLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193405_103600013300018701MarineLQMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQSTTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQSGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193405_104209413300018701MarineAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQTGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0192967_102465113300018730MarineVKDPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMISKYAHEKRTSIEELDDGSKIGGEPTGSFWLAKKDMFRAGKEVLGTHKGLSGEALSSYMDTYFDRAWTNFDVNGSGAVEVLKAPQFMRFLASDQGMSLGESA
Ga0192967_104836613300018730MarineTWGIIKKKKNEILRNCCPSWGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0192967_106872613300018730MarinePWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0193544_102090313300018735MarineLLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193544_102254413300018735MarineGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIGKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192974_105760813300018739MarineQMKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0193534_105670713300018741MarineTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193138_103136423300018742MarineLKHIMKAIVIAALLGLTVGIQKTESTPPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQGTTMAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMSLGESG
Ga0193138_103458423300018742MarineKQMKFLAIAALLGLAAAVEKPEATAPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMISKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193138_103458523300018742MarineKQMKFLAIAALLGLAAAVQKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTSLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193138_103685413300018742MarineQQMRTIALLALVGVASAIRGDPTPAKNAWESVKGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0193138_103878213300018742MarineQQMRTIALLALVGVASAIRGDPTPAKNAWESVKGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFIASDQYMTLGESG
Ga0193138_104117013300018742MarineKQHMRTIAFAALLGLAATSAIKGDPTPPYNAWESVKDGAKDGKYERVLTPHFSADSDDIFMRSMISKYAVEARTDTETLDDGTKVGGEPTGAFWMTQANTLAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQSGKVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193138_105620013300018742MarineKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193000_103838113300018745MarineMKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193000_105068413300018745MarineYGAWESVKDGAEDGHYERVITPNFAGDADDIFMRSMIKKYAVEARTDTEELDDGTKIGGEPTGKFLMTQATTLAASKEVLNTHKGLSGDALQAYLDTYFAKAWAHFDVNQGGDIEVIKMPQFMRFLCSDQSLSLGESG
Ga0193468_105563613300018746MarineTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATCLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192963_105374513300018762MarineKKQMKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0192963_106330213300018762MarineFTLAIAALLSISSAIKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0192827_104902213300018763MarinePYNAWESVKDGAEDGKYGRVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192827_105459813300018763MarineDGKYGRVVTAHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192827_106422513300018763MarineMKTIAIACLLGFVAAAPEPTAPYNAWESVKDGAEDGKYERVITAHFSADTDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTALAAAKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQYMSLAESG
Ga0192827_106426913300018763MarineMRTIAIACLLGLAAAVQKTEKTPPYNAWESVKDGAEDGKYERVITPNFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0192827_106801513300018763MarineTKLRGDPAPPYNAWESVKDGAQDGKYERVITPHFSADSDDIFMRSMIKKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGDALSAYLDTYFKKAWDHFDVNQSGKIEVIKSPQFMRFLASDQYMDLGVSG
Ga0192827_107793313300018763MarinePTPPYNAWESVKDGAEDGKYERKITAHFSADADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0192827_109076313300018763MarineGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQDGKIDVIKMPQFCRFLASDQSLSLGESG
Ga0192827_109332913300018763MarineVAIKSKGDPTPPYNAWESVKDGAEDGKYERVITPHFSGDGDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLTAYMDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0193031_104826723300018765MarineMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193031_105154713300018765MarineMRTIAIAALLGLVASIEIHDSEKTPPYNAWESVKDGAEDGKYERVVTSHFNADSDDIFMRSMITKYAQELRTDTEKLDDGTKLGGEPTGKFVMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGSIEVIKLPQLMRFLASDQYMSLGESG
Ga0193031_105224013300018765MarineMRTIAIACLLGLAAAVEIHGDPTPPYNAWESVKDGAADGKYERVLTSHFSGDADDIFMRSMISKYAQELRTDTDKLDDGTKIGGEPTGKFVMNQASTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG
Ga0193031_105351523300018765MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQSSALAAAKEVLGTHKGLSGDALASYIDTYYAKAWAHFDVNQSGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193031_105561913300018765MarineHGELIINLLQMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAAAKEVLGTHKGLGGDALASYVDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193031_106530313300018765MarineMRTIAIAALLGLVAAVQKTESTPHYNAWESVKDGAEDGKYERVVTPNFSGDADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPIGKFWMTQATALGASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGQIEVTKMPQFMRFLASDQYMSLGESG
Ga0193031_107114013300018765MarineVAAKPEPTPPYNAWESVKDGAEDGKYERVITPNFAADADDIFMRSMIKKYAVEERTDSEELDDGTKIGGEPTGKFWMNQATSLAAAKEVLNTHKGLSGDALSAYLDTYFGKAWAHFDVNQTGEIEVIKMPQFMRFICSDQSLSLGESG
Ga0193031_107218013300018765MarineMRTIAIACLLGLAVAVQKTESTAPYNAWESVKDGAEDGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLASAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG
Ga0193031_108168213300018765MarineNAWESIKDGAEDGKYERVVTPHFSADSDDIFMRSMISKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLNASKEVLHTHKGLSGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0193031_108229713300018765MarineNAWESIKDGAEDGKYERVVTPHFSADSDDIFMRSMISKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTMAAAKEVLATHKGLSGQALADYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMQLGESG
Ga0193031_108558913300018765MarineKDPTYNAWESVKDGAADGKYERVITPHFSSDSDDIFMRSMIKTYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWSNFDVNGSGAVEVIKSPQFMRFLCSDQAMQLGESG
Ga0193031_108593713300018765MarineVAKVGKPEATAPYNAWESVKDGAEDGKYERVVTPHFNGDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQLMRFLASDQNLSLGESG
Ga0193031_108636013300018765MarineAWESVAGGAADGKYERVVTAHFSGDSDDIFMRSMISKYAQELRTDTETLDDGTSVGGEPTGKFMMTKANTEAAAKEVLNTHKGLAGEALAAYMDTYFAKAWSHFDVNQGGAVEVIKMPQFMRFLASDQSMSLGESG
Ga0193031_109281113300018765MarineKYERQVTAHFSGDSDDIFMRSMIKNYAVELRTDTETLDDGTKIGGEPTGKFMMTEANALGAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQGGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0193181_103593013300018766MarineKQMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193181_105342613300018766MarineAIAALLGLAAGIQKTEPTPPYNAWESVKDGAEDGKYERKITAHFSADADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0193181_105458513300018766MarineFTLAIAALLGLTVAVKLDGVDYFQPWEHVPDGAEEGKYERVTPKHFAADSDDLFMRSMIRKYALEEKTPVKDLDDGTKVGGEPTGKFFLDKAKARAASSEVLHTHKGLSGATLEDYLTTYFEKAWGHFDVMRTGRIEVLRMPSFMRFLASD
Ga0193407_104223913300018776MarineQMKYLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193407_104419913300018776MarineLQMKTIAIACLLGLASSTRLNGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQTGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0193407_105800413300018776MarineQMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQSTALAAAKEVLGTHKGLSGDALASYIDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193408_107319113300018778MarinePTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQTGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0193149_104617113300018779MarineKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAASKEVLGTHKGLGGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193149_106693713300018779MarineGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKIGGEPTGKFNMTQSTTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192832_105587013300018782MarineGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193124_104005623300018787MarineQMRTIAIACLLGLAVAINKPEKTPPYNAWDSVKDGAEDGKYERVVTANFSADSDDIFMRSMISKYAQEKRTDTDELDDGTKIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGAIDVIKMPQFMRFLCSDQSMQLGESG
Ga0193124_105178413300018787MarineFAIAALLGLVACSKLNGDPTPAKNAWESVKGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFIASDQYMTLGESG
Ga0193124_105382413300018787MarineFAIAALLGLVACSKLNGDPTPAKNAWESVKGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0193124_106521613300018787MarineKDGAVDGKYERVVTPHFSGDDDDIFMRSMIKTYAHEQRTPIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLKGDKLSSYMDTYFDRAWENFDVNGSGAVEVIKAPQFMRFLCSDQTMQLGESG
Ga0192950_104227513300018791MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDVAKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192950_104283413300018791MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDVAKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMTLGESG
Ga0192950_107323313300018791MarineEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0193117_105817713300018796MarineKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193306_105049313300018800MarineVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0193306_106145813300018800MarineEKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193306_107545213300018800MarineIAIACLLGFVAAGDPAAPYNAWESVKDGAADGKYERVITAHFSADSDDIFMRSMITKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0192824_107882613300018801MarineKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192824_109091013300018801MarineFAALLGVAVAIRGDPTPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0193183_106796813300018811MarinePEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192829_107224613300018812MarineKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192829_107225313300018812MarineKFLAIAALLGLAAAVQKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193412_105553813300018821MarineKQMKYLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193053_105049523300018823MarineKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193053_105049823300018823MarineKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193053_105050223300018823MarineKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193053_105064213300018823MarineKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193053_107195013300018823MarineIACLLGLASSTRLNGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGAFWMTEANALAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLCSDQGMSLGESG
Ga0193048_106526713300018825MarineLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193191_105561413300018830MarineKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193191_106812813300018830MarineKTIAIAALLGLAAGIQKTEPTPPYNAWESVKDGAEDGKYERKITAHFSADADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0192949_107645813300018831MarineKQMKFFAIAALLGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192949_108304913300018831MarineKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0194240_100664013300018832MarineMQAAEVSSGVILAETAQTMPTGLVEMSFKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0194240_101213523300018832MarineMKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0194240_101218923300018832MarineMKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0194240_102349013300018832MarineINKPEKTAPYNAWDSVKDGAEDGKYERVVTSHFSADSDDIFMRSMITKYAQEKRTDTDELDDGTKIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGAIDVIKMPQFMRFLCSDQSMQLGESG
Ga0193302_105706613300018838MarineKFLAIAALCGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193302_106617513300018838MarineTFAIAALLGLAAASKISGDPTPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMISKYAVEARTDTETLDDGTKVGGEPTGAFWMTQGNTLAAAKEVLNTHKGLSGDALAAYIDTYFAKAWAHFDVNQSGKVEVIKMPQFMRFLASDQYMPLGESG
Ga0193302_106649013300018838MarineKTAPYNAWESVKDGAEDGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193200_123999413300018840MarineKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193219_104744213300018842MarineKYLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193219_105039313300018842MarineQMKAAVLAALLGLTVAIKTTGDPTPAYNAWESVKDGAADGKYERVVTPHFSGDSDDIFMRSMISKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALAASKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQSLSLGESG
Ga0193253_110144313300018846MarineKQMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTANFSSDGDDIFMRSMIKKYAQENRTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNRDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0193253_110319013300018846MarineQMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITPNFSADDDDIFMRSMIKKYAVEKRTDHEELDDGTKVGGEPTGTFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0193253_110441513300018846MarineKQMKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193253_110604113300018846MarineQMKYFALLALISVAAAKPEATDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTANAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGQVEVLKMPQFMRFICSDQRMSLGESG
Ga0193253_110927513300018846MarineILALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITGHFSADSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALGSYMDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMGLGESG
Ga0193253_112567513300018846MarineAFAIAALLGLAAAGDTKPTAPYGAWESIKDGAEDGHYERIITPHFSGDSDDIFMRSMIKKYAVEARTDTTTLKDGTEIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGEALSAYLDTYFGKAWAHFDVNQTGEVEAIKMPQFMRFLASDQNLSLGESG
Ga0193253_113862113300018846MarineKTESTPSYNAWESVKDGAEDGKYERILTPHFSGDSDDIFMRSMIKKYAVEARTDTTTLDDGTKIGGEPTGKFWMTQATALAASKEVLNTHKGLAGEALGAYLDTYFAKAWAHFDVNQGGEIEVIKMPQFMRFLASDQNLSLGESG
Ga0192958_112674013300018853MarineGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193072_108033713300018861MarineALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193308_105308713300018862MarineKQMKYLAIAALLGLAAAVQKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193308_105452213300018862MarineKFLAIAALCGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193421_108760613300018864MarineLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSSDSDDIFMRSMISKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193533_108967813300018870MarineQMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193533_110860713300018870MarineAIAALLGLVASIEIHDSEKTPPYNAWESVKDGAEDGKYERVVTSHFNADSDDIFMRSMITKYAQELRTDTEKLDDGTKLGGEPTGKFVMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGSIEVIKLPQLMRFLASDQYMSLGESG
Ga0193162_108515713300018872MarineKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0192977_108064713300018874MarineKQMKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0193027_107912813300018879MarineKQMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192908_1005620513300018881MarinePPYNAWESVKDGAEDGKYERVITPNFSGDSDDIFMRSMIKKYAVEERTDTVTLDDGTKIGGEPTGKFMMTQSTTLAASKEVLGTHKGLSGDALSAYLDTYFSKAWAHFDVNQKGSVEVIKMPQFMRFLASDQYMSLGESG
Ga0193471_107518713300018882MarineLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193311_1004116313300018885MarineMKYLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193311_1004255223300018885MarineLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193304_108858313300018888MarineKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATCLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193028_107548123300018905MarineKQMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193028_111273213300018905MarineVASIEIHDSEKTPPYNAWESVKDGAEDGKYERVVTSHFNADSDDIFMRSMITKYAQELRTDTEKLDDGTKLGGEPTGKFVMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGSIEVIKLPQLMRFLASDQYMSLGESG
Ga0193548_1001885013300018907MarineGAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193548_1001928913300018907MarinePPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192868_1004942823300018913MarineATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFIRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193420_1007638713300018922MarineLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSSDSDDIFMRSMISKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192989_1011690013300018926MarineKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTANFSSDGDDIFMRSMIKKYAQENRTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNRDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0192989_1012174313300018926MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITPNFSADDDDIFMRSMIKKYAVEKRTDHEELDDGTKVGGEPTGTFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0192989_1012376013300018926MarineKYFALLALISVAAAKPEATDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTANAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGQVEVLKMPQFMRFICSDQRMSLGESG
Ga0192989_1013144013300018926MarineAFAIVALFVATAAAKTESTPSYNAWESVKDGAEDGKYERILTPHFSGDSDDIFMRSMIKKYAVEARTDTTTLDDGTKIGGEPTGKFWMTQATALAASKEVLNTHKGLAGEALGAYLDTYFAKAWAHFDVNQGGEIEVIKMPQFMRFLASDQNLSLGESG
Ga0192989_1013207313300018926MarineMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTGHFSADSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALGSYMDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMGLGESG
Ga0192989_1013410513300018926MarineKYIAIAALIASVSAVTLGKPEATAPYAAWESVEDGAEDGKYERIVPGHFKGDKDDLFMRSMIKKYAVEARTDHEVLEDGTKIGGEPTGAFWMNQATSLAAAKEVLKTHKGLKGDMLSAYLDTYFAKAWAHFDVNQTGEIEVIKMPQFMRFLASDQYMQLGESA
Ga0193260_1011453513300018928MarineFALAALLGLAVAIRDPTAPYNAWESVADGAADGKYERVVTPNFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0193260_1013271413300018928MarineLKHIMKAIVIAALLGLAVGIQKTESTAPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMSLVESG
Ga0193426_1010476023300018942MarinePTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193287_109731713300018945MarineLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193087_1018974113300018964MarineMKYQAIAALLGLVSATKMTGDVTPTAPYNAWESTKDGAKDGKYERVVTGHFSADADDIFMRSMITKYAVELRTDTETLDDGTTVGGEPTGKFMMTKSTTLAAAKEVLNTHKGLAGDALSAYLDTYFDKAWAHFDVNQTGSVEVIKMPQLMRFLASDQYMQLGESG
Ga0193178_1004726813300018967MarineKTIAIAALLGLVAAGDPTPPYNAWESVKDGAEDGKYERKVTAHFSGDADDIFMRSMITKYAVEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0193178_1004838013300018967MarineLVGLAAASSIRGDPTPPYNAWESVADGAKDGKYERVVTSHFSADSDDIFMRSMIKKYAIEARTDTETLDDGTKVGGEPTGAFWMTQANALAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193178_1005047023300018967MarineRTLAIAALLGMVTCSKLNGDPTPPYNPWESVKDGAADGKYERVVTAHFSADADDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0193178_1005143713300018967MarineQMRTIAIACLLGLAVAINKPEKTPPYNAWDSVKDGAEDGKYERVVTPNFSADSDDIFMRSMITKYAQEKRTDTDELDDGTKIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGSIDVIKMPQFMRFLCSDQSMQLGESG
Ga0193178_1005337913300018967MarineKFLAIAALLGLAAAVQKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193178_1005387813300018967MarineKFLAIAALLGLAAAVQKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLAESG
Ga0193178_1005984613300018967MarineGLVACNKLEGDPTPPYNAWESVKDGAEDGKYERVITPNFSGDADDIFMRSMIKKYAVEKRTDTETLDDGTKIGGEPTGKFMMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFSKAWAHFDVNQTGSVEVIKMPQFMRFLASDQYMSLGESG
Ga0193178_1006276913300018967MarineYNAWDSVKDGAADGKYERVVTPHFSAYSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0193178_1007569513300018967MarineWESVKDGAEDGKYERVITAHFSADTDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTALAAAKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQYMSLAESG
Ga0193254_1010277013300018976MarineQMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTANFSSDGDDIFMRSMIKKYAQENRTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNRDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0193254_1010907313300018976MarineAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITGHFSADSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALGSYMDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMGLGESG
Ga0193254_1010966913300018976MarineAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITPNFSADDDDIFMRSMIKKYAVEKRTDHEELDDGTKVGGEPTGTFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0193254_1011126013300018976MarineMKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193254_1011932613300018976MarineFAIAALLGLATAGDTKPTAPYGAWESIKDGAEDGHYERIITPHFSGDSDDIFMRSMIKKYAVEARTDTTTLKDGTEIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGEALSAYLDTYFGKAWAHFDVNQTGEVEAIKMPQFMRFLASDQNLSLGESG
Ga0193353_1021807413300018977MarineVKDGADDGKYERVVTAHFSGDADDIFMRSMIKKYAQEERTDTETLDDGSKIGGEPTGKFWMTQGTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQNMGLGESG
Ga0193353_1022248713300018977MarineGAEDGKYERVVTAHFSGDSDDIFMRSMIKKYAVEARTDTDELDDGTKIGGEPTGKFWMTQSTALAAAKEVLNTHKGLGGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFICSDQNMQLGESG
Ga0193353_1022826613300018977MarineVKDGAEEGKYERVITAHFSGDADDIFMRSMIKKYAQEERTDTETLDDGSKIGGEPTGKFWMTQGTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQNMGLGESG
Ga0193353_1023537513300018977MarineAEDGKYERVVTPHFSGDADDIFMRSMIKKYAQEQRTDTTELDDGTKIGGEPTGKFTMNQAACLAASKEVLNTHKGLSGDALAAYLDTYFGKAWAHFDVNQSGDIEVIKMPQFMRFLASDQSLSLGESG
Ga0193540_1013620523300018979MarineMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADYDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193540_1013621123300018979MarineMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADYDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193540_1018199213300018979MarineTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAAAKEVLGTHKGLSGDALASYVDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193540_1018289613300018979MarineAAAVEIHGDPTPPYNAWESVKDGAADGKYERVLTSHFSGDADDIFMRSMISKYAQELRTDTDKLDDGTKIGGEPTGKFVMNQASTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG
Ga0193540_1019963213300018979MarineDGKYERVVTPHFSADSDDIFMRSMISKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLNASKEVLHTHKGLSGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0192961_1016212313300018980MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITANFSADDDDIFMRSMIKKYAVEKRTDHEELDDGTKVGGEPTGTFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVCSDQNMSLGESG
Ga0192961_1022429913300018980MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITANFSADDDDIFMRSMIKKYAVEKRTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYVDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0192968_1012584613300018981MarineMKFTLAIAALLSISSAIKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0192947_1018139613300018982MarineHGELIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192947_1018140013300018982MarineHGELIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESGXATRKXNEQNGKDFLKLL
Ga0192947_1018140223300018982MarineHGELIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAASKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192947_1020124413300018982MarineMKTFAIAALLGVVVCTKIGDPTPAYNPWESVKGGADDGKYERVVTANFSADADDIFMRSMISKYAIESRTDTESMDDGTKVGGEPTGKFWMTQSGTLAAAKEVLGTHKGLSGDALSAYLDTYFSKAWAHFDVNQSGKIEVIKMPQFMRFVASDQYMSLGESG
Ga0192947_1020208713300018982MarineGTPYEQSPFNAWDSVKDGAENGQYERVVTPHFSADADDIFMRSMIKKYAVEERTDKEMAADGQISGGEPTGIFWITPKEANWASHEVMKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192947_1020370313300018982MarineTWDNLIIKLSFRITMKFLAIAALLGLVSCVQLEGPSAPFNAWQSSKDGPYERVITPHFSADGDDIFMRSMIKKYAQEERTDTDTLDDGQKVGGEPTGKFWMTQSTSLGAAKEVLNTHKGLSGDQLSAYLDTYFQRSWDHFDVNGSGQIEVIKMPQFMRFLASDQYMSLGESG
Ga0192947_1021992513300018982MarineTWGILIINNNLEMRTIAIACLLGLVASSKLRGDPTPPYNAWDSVKGGTDDGKYERVVTPHFSADTDDIFMRSMITKYAIEERTDTDTLDDGRKVGGEPTGKFWMTQATTLGAAKEVLSTHKGLKGDALDAYLDTYFNKAWAHFDVNESGKVEVIKMPQYMRFLASDQFMSLGESG
Ga0192947_1024269313300018982MarinePVEVAPFNAWDSVKDGAVEGKYERVLTPHFSADSDDIFMRSMIKKYAVEERTDKDILPDGQKIGGEPTGIFWITPKEAKWASEEVLKTHKGLSGAALDAYMTTYFQRCWDNFDVNKEGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0193554_1023272313300018986MarineVEKQVMEKKPEPTAPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTRIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193030_1015895213300018989MarineMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193030_1017267423300018989MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAAAKEVLGTHKGLGGDALASYVDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193030_1017277713300018989MarineMGIILNIKQMRTFAIALLIAAVAAKPEPTPPYNAWESVKDGAEDGKYERVITPNFAADADDIFMRSMIKKYAVEERTDSEELDDGTKIGGEPTGKFWMNQATSLAAAKEVLNTHKGLSGDALSAYLDTYFGKAWAHFDVNQTGEIEVIKMPQFMRFICSDQSLSLGESG
Ga0193030_1018426613300018989MarineHGIIKLNLQMRAIVIAALCGLAVAKVGKPEATAPYNAWESVKDGAEDGKYERVVTPHFNGDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQLMRFLASDQNLSLGESG
Ga0193030_1018640813300018989MarineHGEIINNIMRTIAIAALLGLAAAITVEKSEATPPYQPWEHTKDGAKEGNYERVTTPHFSADSDDIFMRSMITTYAVEARTDTVTHDDGTKSGGEPTGKFLMTKSGTLAAAKEVLGTHKGLAGGALSAYLDTYFDKAWGHFDVNQTGMVEVIKMPQLMRFLASDQSLSLGESG
Ga0193030_1019126413300018989MarineMRTIAIACLLGLAVAVQKTEKTPAYNAWESVKDGAEDGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNMGLGESG
Ga0193030_1019413813300018989MarineHGDYNNKIKQQMRTIAIACLLGLAASMKIEDPEKTAPYNAWESIKDGAEDGKYERVVTPHFSADSDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTMAAAKEVLATHKGLSGGALSDYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMQLGESG
Ga0193030_1019416013300018989MarineHGDYNNKIKQQMRTIAIACLLGLAASMKIEDPEKTAPYNAWESIKDGAEDGKYERVVTPHFSADSDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTMAAAKEVLATHKGLSGQALADYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMQLGESG
Ga0193030_1019706813300018989MarineTWGIIKLLKVQMKAAVIALFLGLAVAIKSTDSEKTAPYNAWESVKDGKEDGKYERQVTAHFSGDSDDIFMRSMIKNYAVELRTDTETLDDGTKIGGEPTGKFMMTEANALGAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQGGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0193030_1019782913300018989MarineHGIIKLNLQMRAIVIAALCGLAVAKVGKPEATAPYNAWESVKDGAEDGKYERVVTPHFNGDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVTKMPQLMRFLASDQNLSLGESG
Ga0193030_1019880513300018989MarineMGNNKIKQQMRTIAIACLLGLAASMTVEGDPTPPYNAWESIKDGAEDGKYERVVTPHFSADSDDIFMRSMISKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLNASKEVLHTHKGLSGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMQLGESG
Ga0193030_1019997213300018989MarineMRTIAFAALLGLAVAVQKTEKTAPYNAWESVKDGAEDGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLASAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKLPQVMRFLASDQYMSLGESG
Ga0193030_1020596613300018989MarineMRTIAIACLLGLAVAVQKTEKTPAYNAWESVKDGAEDGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0193030_1020724013300018989MarineMKFLAIAALLGLTVAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLSAYMDTYFAKAWAHFDVNQKGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0193030_1020930913300018989MarineMGIIYLLNHTMKAIVIAALLGLTVAIQTKGDPTAPYNAWESVEDGAADGKYERVITPHFSGDGDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLSAYMDTYFAKAWAHFDVNQKGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0193030_1021209613300018989MarineMRTFAIAALLGLAAASRTAPYNAWESVAGGAADGKYERVVTAHFSGDSDDIFMRSMISKYAQELRTDTETLDDGTSVGGEPTGKFMMTKANTEAAAKEVLNTHKGLAGEALAAYMDTYFAKAWSHFDVNQGGAVEVIKMPQFMRFLASDQSMSLGESG
Ga0193030_1023022913300018989MarineLFLGLAVAIKSQDSEKTAPYNAWESVKDGAADGKYERVTTAHFSGDGDDIFMRSMISKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALGAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG
Ga0193030_1023359213300018989MarineMRTIAIACLLGLAAGIQKTESTPPYNAWESVKDGAEDGKYERVLTPHFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGQIEVIKMPQFMRFLASDQYMSLGESG
Ga0193030_1024780113300018989MarineQPWESTKDGAKEGNYERVTTPNFSADSDDIFMRSMIDTYAVEERTDTVTHDDGTKSGGEPTGKFWMNQAGALSASKEVLGTHKGLSGEALSAYLDTFFAKTWGHFDVNQSGQVEVTKMPQFMRFLASDQNLSLGESG
Ga0193030_1027202513300018989MarineEDGKYERVITPNFSGDSDDIFMRSMIKKYAVEARTDTDELDDGTKIGGEPTGKFLMTQSTALAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGDIEVIKMPQFMRFLCSDQNLSLGESG
Ga0193030_1027902913300018989MarineVLEKDPTYNAWESVKDGAADGKYERVVTPNFSADSDDIFMRSMISKYAFEKRTSIEELDDGTKIGGEPTGSFWLSKKDMFRAAKEVLGTHKGLSGDKLDSYLDTYFDRAWSNFDVNGGGSVEVIKAPQFMRFIASDQTLSLGESG
Ga0193030_1028471913300018989MarineAWESVGGGAADGKYERVVTAHFAADTDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG
Ga0193030_1029211913300018989MarineDGAEDGKYERVTTAHFSADSDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLGAAKEVLATHKGLSGGALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMDLGVSG
Ga0193030_1029720813300018989MarinePTPPYAAWESVKDGAEDGKYERVTTANFSTGKDDIFMRSMIEKYAVEERTDTEVLEDGTKIGGEPTGKFWMNQATTLAAAKEVLATHKGLTGGAAAAYLDTYFNKAWAHFDVNQTGEIEVIKSPQFMRFLLSDQYTQLGESG
Ga0193257_1020554313300018997MarinePEATDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTANAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGQVEVLKMPQFMRFICSDQRMSLGESG
Ga0193034_1007726813300019001MarineMKTIAIAALLGLVASTQLXXXXQLRGDPSPAYNPWESVKGGAEEGKYERVVTAHFSADSDDIFMRSMISKYAQEARTDTETLDDGTKVGGEPTGKFWMNKSATMSASKEVLGTHKGLAGDALSAYMDTYFDKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMSLLP
Ga0193034_1008911413300019001MarineMRTIAIACLLGLAVAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFSGDSDDIFMRSMIKKYAVEARTDTDELDDGTKIGGEPTGKFWMTQSTALSAAKEVLNTHKGLGGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFICSDQNMQLGESG
Ga0193034_1011281513300019001MarineSTAPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193034_1011547313300019001MarineCHPKPEKTAPYNAWESVKDGAEDGKYERVVTAHFSGDSDDIFMRSMIKKYAVEERTDHDELDDGTKIGGEPTGKFWMTQSTALGAAKEVLNTHKGLGGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFICSDQNMQLGESG
Ga0193034_1015021713300019001MarineGDPTPAYNAWESVKDGSKDGKYERVITAHFSGDADDIFMRSMITKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193034_1016038513300019001MarineAWESVKDGAKDGKYERVVTSHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGAFWMTEGNTLAASKEVLNTHKGLSGDALAAYLDTYYAKAWAHFDVNQSGKIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193034_1016926713300019001MarineTWGIINKQMKTIAIACLLGLATAIKAPVPTPPYNAWNSIKGGAEEGKYERVITPHFSADSDDIFMRSMISKYAVEERTDSDITDMGEKIGGEPTGIFWMTQQTAMWAAQEVLNAHKGLWGDSLKAYLDTYFAKAWEHFDVNKTGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0193044_1019688313300019010MarineTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193569_1028934623300019017MarineMKFLAIAALLGLTVAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193569_1028934923300019017MarineMKFLAIAALLGLTVAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0193569_1030101023300019017MarineKQMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIGKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193569_1041681213300019017MarineAIACLLGLAAAVEIHGDPTPPYNAWESVKDGAADGKYERVLTSHFSGDADDIFMRSMISKYAQELRTDTDKLDDGTKIGGEPTGKFVMNQASTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG
Ga0193538_1021258913300019020MarineKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192951_1022180813300019022MarineMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESGXATRKXNEQNGKDFLKL
Ga0192951_1023439813300019022MarineMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAASKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMTLGESG
Ga0192951_1030527113300019022MarineMGAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0192951_1030540913300019022MarineHGIILIINNNLEMRIIAIACLLGLVASSKLRGDPTPPYNAWDSVKGGTDDGKYERVVTPHFSADTDDIFMRSMITKYAIEERTDTDTLDDGRKVGGEPTGKFWMTQATTLGAAKEVLSTHKGLKGDALDAYLDTYFNKAWAHFDVNESGKVEVIKMPQYMRFLASDQFMSLGESG
Ga0192951_1039688013300019022MarineMGYYLNMRTFAIVCLLGLAAAINKPSGKPAVPGTPYEQSPFNAWDSVKDGADNGQYERVVTPHFSADADDIFMRSMIKKYAVEERTDKEMAADGQISGGEPTGIFWITPKEANWASHEVMKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEEKIEVIKMPQFMRFLASDQYMS
Ga0193545_1008104513300019025MarineMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIGKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192909_1011995323300019027MarineMRTFAIALLIAAVAAKPEPTPPYNAWESVKDGAEDGKYERVITPNFSGDSDDIFMRSMIKKYAVEERTDTEELDDGTKVGGEPTGKFMMTQSTALAAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGDIEVIKMPQFMRFLCSDQSLSLGESG
Ga0192909_1015763113300019027MarineVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192909_1029665813300019027MarineHGGAADGKYERVVTSHFSADADDIFMRSMIKKYAQEERTDTETLDDGSKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALGAYIDTYFAKAWAHFDVNQTGSVEVIKMPQFMRFLASDQYMSLGESG
Ga0193516_1024646113300019031MarineTWDGAADGKYERVPTAHFSGDADDIFMRSMITKYAVELRTDTETLDDGTKVGGEPTVKFMMTEANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG
Ga0193516_1030049413300019031MarineAWESVKDGAADGKYERVITSHFSGDGDDIFMRSMITKYAVEERTDTETLDDGQKVGGEPTGKFWMTQSTAANAAKEVLNTHKGLSGDLLSAYMDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0192869_1029108313300019032MarineTQSTWGNLKNMRTFAIACLLAVVAAKPEATAPYNAWESVKDGKEDGKYERVITPHFSGDSDDIFMRSMITKYAVEERTDTDELDDGTKIGGEPTGKFMMTQANSLAAAKEVLGTHKGLAGDALAAYLDTYFAKAWAHFDVNQTGAIEVIKMP
Ga0192869_1038858413300019032MarineMGIKFRIQQMRTIAVACLLGLASAIQKPEATPAYNAWESVKDGAEDGKYERVVTPHFSGDGDDIFMRSMIKKYAVEERTDTEELDDGTKIGGEPTGKFNMTKANALGAAKEVLNTHKGLAGDALSAYIDTYFDKAWSHFDVNQTGKIEVIKMPQFCRFIASDQSMSLGESG
Ga0192869_1038961713300019032MarineKTEETKPYNAWESVKDGAEDGKYERIITPHFSGDSDDIFMRSMIKKYAVEARTDTTTLDDGTEIGGEPTGKFWMNQSGALAASKEVLNTHKGLAGDSLSAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQNLSLGESG
Ga0192869_1052223813300019032MarineTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAASKEVLGTHKGLGGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSL
Ga0193037_1031708713300019033MarineIANGAADGKYERVTTTNFSGDSDDIFMRSMIQKYGLEEKTPTKELDDGTKVGGEPTGRFWMDSAKTRAAASEVLGTHKGLKGEALQSYLDTYFDKAWGHFDVNRGGMVEVIKMPQFMRFLASDQYMSLGESG
Ga0193037_1033342613300019033MarineMKTIAIACLLGFVAAGDPTPPYNAWESVKDGAEDGKYERVVTAHFSADTDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTALAAAKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQYMSLAESG
Ga0192945_1015147413300019036MarineMGNIINCISLIIIYYLNMRTFAIVCLLGLAAAINKPSGKPAVPGTPYEQSPFNAWDSVKDGAENGQYERVVTPHFSADADDIFMRSMIKKYAVEERTDKEMAADGQISGGEPTGIFWITPKEANWASHEVMKTHKGLSGQMLEDYINTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLQP
Ga0192945_1016782423300019036MarineMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAASKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMTLGESG
Ga0192945_1018833723300019036MarineMKTFAIAALIGLVACTKLNGDPTPPYNAWESVKGGADDGKYERVVTAHFSADADDIFMRSMIGKYAQEARTDTETLDDGTKVGGEPTGKFWMTQATTLAASKEVLGTHKGLSGDALSAYLDTYYAKAWAHFDVNQSGKIEVIKMPQFMRFVASDQYMSLGESG
Ga0192945_1019474913300019036MarineHGNNLIIKLSFRITMKFLAIAALLGLVSCVQLEGPSAPFNAWQSSKDGPYERVITPHFSADGDDIFMRSMIKKYAQEERTDTDTLDDGQKVGGEPTGKFWMTQSTSLGAAKEVLNTHKGLSGDQLSAYLDTYFQRSWDHFDVNGSGQIEVIKMPQFMRFLASDQYMSLGESG
Ga0192945_1019731713300019036MarineMGIILIINNNLEMRTIAIACLLGLVASSKLRGDPTPPYNAWDSVKGGTDDGKYERVVTPHFSADTDDIFMRSMITKYAIEERTDTDTLDDGRKVGGEPTGKFWMTQATTLGAAKEVLSTHKGLKGDALDAYLDTYFNKAWAHFDVNESGKVEVIKMPQYMRFLASDQFMSLGESG
Ga0192945_1022391923300019036MarineQLRGDPTPAYNAWDSVKGGADDGKYERVVTPNFSGDSDDLFMRSMISKYAVEARTDTETLDDGTKVGGEPTGKFWMTQANALGAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFARFLASDQYMQLGESG
Ga0192945_1022728223300019036MarineSVKDGAEDGHYERVITPNFSGDADDIFMRSMIKKYSVEARTDTEELDDGTKIGGEPTGKFLMNQATTLAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGDIEVIKMPQFMRFLCSDQSLSLGESG
Ga0192945_1028165813300019036MarineVSTQSTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSL
Ga0192945_1028166113300019036MarineVSTQSTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSL
Ga0193123_1026324213300019039MarineTWGIINLLIRLKHIMKAIVIAALLGLTVGIQKTESTPPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQGTTMAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMSLGESG
Ga0193123_1036091013300019039MarineHGAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193123_1043426213300019039MarineIYNAWESVKDGAVDGKYERVVTPHFSGDDDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMYRASKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGSGAVEVIKAPQFMRFLCSDQTMQLGESG
Ga0192857_1031296913300019040MarineMRTFAIACLLGAAVAVNLNKPVEVAPYNAWDSVKDGAADGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDTDILPDGQKIGGEPTGIFWITPKEAKWASEEVLATHKGLKGPALEAYMTTYFQRCWDNFDVNKEGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193336_1034139013300019045MarineMGNLFIKLRKNIMRAFVIAALLGLATCIRDSEKTPPYNAWESVKDGKEDGKYERVTTAHFSADSDDIFMRSMINKYAQETRTDTETLDDGTKLGGEPTGKFIMTQSTSLAAAKEVLATHKGLSGDALSAYLDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG
Ga0193336_1037341213300019045MarineMKFTLAIAALLAVSEAVKLEFDTFQPWESVPDGAEDGKYERVLTKNFASDSDDLFMRSMIKKYALEQKTPTKELDDGTKVGGEPTGKFWLDKSKAKAAASEVLGTHKGLSGADLDAYLATYFDKAWGHFDVNRTGMIEVIKMPSFMRFLASDQYMQLGESA
Ga0193336_1039188513300019045MarinePEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193336_1046595713300019045MarineIQKPEKTPPYNAWESVKDGAEDGKYERVVTSHFSGDSDDIFMRSMIKKYAVEERTDSDELDDGTKIGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFICSDQNMQLGESG
Ga0193336_1047382713300019045MarineAIRDTEKTPPYNAWESVKDGKEDGKYERVTTANFSADSDDIFMRSMINKYAQETRTDTETLDDGTKLGGEPTGKFIMTQSTSLAAAKEVLATHKGLSGDALSAYLDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG
Ga0193336_1050887313300019045MarineYNAWESVKDGAEDGKYERIITPNFSGDADDIFMRSMIKKYAVEKRTDTETLDDGTKIGGEPTGVFMMTQSTALAASKEVLNTHKGLSGDALSAYLDTYFSKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0193336_1052232613300019045MarineAPYNAWESVKDGAEDGKYERVITPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0193336_1059135013300019045MarineTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLLP
Ga0193336_1064198613300019045MarineTWGIYLLNKLHMRTIAIACLLGLAAAAEKPEKTPPYNAWESVKDGAEDGKYERVITANFSSDSDDIFMRSMIKKYAVEMRTDTEELDDGTKIGGEPTGKFNMTQANALAASKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193336_1065817713300019045MarineESVADGAKDGKYERVVTPHFSADSDDIFMRSMIKKYAVEARTDTETLDDGTKVGGEPTGAFWMTEANALAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLCSDQSMALGESG
Ga0193336_1067516813300019045MarineKYERVVTPHFSSDADDIFMRSMISKYAVEERTDTETLDDGTKIGGEPTGKFNMTQSTALAAAKEVLATHKGLSGDALAAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFMRFIASDQYMSLGESG
Ga0193549_1003460613300019047MarineGAIAALLGLAVAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193549_1003753013300019047MarineGAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIGKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192966_1021468013300019050MarineMKFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0192826_1013759413300019051MarineMQAVEVSSGVILAETAQTMPTGLVEMSFKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192826_1022441913300019051MarineMKTIAIAALIGLVACTKLQGEPEKTPPYNAWESVKDGAEDGKYERVVTANFKGDDDDIFMRSMIKKYAVEMRTDTETLDDGTKIGGEPTGKFMMTQSTSLAAAKEVLATHKGLSGDALSAYLDTYFSKAWAHFDVMQDGKIDVIKMPQFMRFLASDQYMSLGESG
Ga0192826_1022619713300019051MarineMKTIAFACLLGLTVATKLRGDPAPPYNAWESVKDGAQDGKYERVITPHFSADSDDIFMRSMIKKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTTLGAAKEVLATHKGLSGDALSAYLDTYFKKAWDHFDVNQSGKIEVIKSPQFMRFLASDQYMDLGVSG
Ga0192826_1022686313300019051MarineHGNLFIKLRTNIMRAFVIAALLGLTVAIRDTEKTPPYNAWESVKDGKEDGKYERVVTAHFSGDADDIFMRSMITKYAQETRTDTETLDDGTKLGGEPTGKFIMTQATALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGSIDVIKMPQFMRFLASDQYMTLGESG
Ga0192826_1022797223300019051MarineTWDNLIIKLIMKTIAIAALLGLAAGIQKTEPTPPYNAWESVKDGAEDGKYERKITAHFSADADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESGXAKDKXKNKVSMDCLKLL
Ga0192826_1023918013300019051MarineMGNNKLIKLQMKAVALACLLGLAVAIKQGDKEKTAPYNAWESVKDGAEDGKYERVVTAHFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTKIGGEPTGKFMMTEANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQDGKIDVIKMPQFCRFLASDQSLSLGESG
Ga0192826_1024754513300019051MarineMRTIAIACLLGLTVAVQKTEKTAPYNAWESVKDGAEDGKYERVVTPNFSADADDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQDGKIDVIKMPQFCRFLASDQSLSLGESG
Ga0192826_1025084813300019051MarineMRTIAIACLLGLAAAVQKTEKTPPYNAWESVKDGAEDGKYERVITPNFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMDLGVSG
Ga0192826_1025087713300019051MarineMKAFAIAALLGLTVAIKSKGDPTPPYNAWESVKDGAEDGKYERVITPHFSGDGDDIFMRSMITKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTAAAASKEVLNTHKGLSGDLLTAYMDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLCSDQRMQLGESG
Ga0192826_1026672313300019051MarineMKFTLAIAALLTVSNAVQLQKDYFQPWEHVKDGAAEGKYERATTANFAGDGDDIFMRSMIQKYALEEKTKIVELDDGTKVGGEPTGKFWLDQDKARAAASEVLGTHKGLSGAGLASYLDTYFAKAWGHFDVNRTGMIEVIKMPSFMRFLASDQYMSLGESG
Ga0192826_1026874013300019051MarineMKTIAIACLLGLAASIEIKGDPTPPYNAWESVKDGAEEGKYERVITPHFSSDSDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGGALADYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG
Ga0192826_1027389313300019051MarineTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQSTTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQSGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0192826_1027856313300019051MarineMGKTEKTPPYNAWESVKDGAEDGKYERVITKNFSGDDDDIFMRSMIKKYAIEKRTDTEILDDGTKIGGEPTGVFMMTQATSMAAAKEVLNTHKGLSGDLLSAYLDTYFGKAWAHFDVNQTGSIEVIKMPQFMRFLCSDQYMQLGESG
Ga0192826_1029055613300019051MarineTWGINKQKNKQMKSIAIACLLGLVAAVRIEDSEKTAPYNAWESVKDGAKDGKYERKVTANFSSDDDDIFMRSMIKKYAIEERTDTETLDDGTKVGGEPTGKFNMTQSTALAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0192826_1029143213300019051MarineATAPYNAWESVKDGAADGKYERVVTSHFSSDADDIFMRSMIKKYAQEERTDTETLDDGSKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLSGDALQAYIDTYFAKAWAHFDVNQTGSVEVIKMPQFMRFLASDQYMSLGESG
Ga0192826_1029561313300019051MarineVAINKPEKTPPYNAWESVKDGAADGKYERVPTAHFSGDADDIFMRSMITKYAVELRTDTDELDDGTKIGGEPTGKFMMTQGNALAASKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQSLSLGESG
Ga0192826_1032638313300019051MarineKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLLP
Ga0192826_1033531013300019051MarineEDGKYERVITPHFSADSDDIFMRSMIKKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGDALSAYLDTYFKKAWDHFDVNQSGKIEVIKSPQFMRFLASDQYMDLGVSG
Ga0192826_1034257113300019051MarinePYNAWESVKDGAEDGKYERVITANFSSDSDDIFMRSMIKKYAVEMRTDTEELDDGTKIGGEPTGKFNMTQANALAASKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGMIEVIKMPQFMRFLCSDQYMALGESG
Ga0192826_1035208413300019051MarineHGAAVRIEDSEKTAPYNAWESVKDGAKDGKYERKVTANFSSDDDDIFMRSMIKKYAIEERTDTETLDDGTKVGGEPTGKFNMTQSTALAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0192826_1036203713300019051MarineNAWESVKDGAADGKYERVITSHFSADTDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGTGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0192826_1036671213300019051MarineYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0193208_1059414713300019055MarineYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLAESG
Ga0193051_11178313300019084MarineALLGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0188866_102306013300019095Freshwater LakeKQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0188866_102590113300019095Freshwater LakeKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0188866_103076113300019095Freshwater LakeKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0188866_103324313300019095Freshwater LakeNTQMRAIVIAAFLGLAASKVGKPEPTAPYGAWESVKDGAEDGKYERIITPNFKGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALGAYIDTYFGKAWSHFDVNQTGEVEVTKMPQLMRFLASDQSLSLGESG
Ga0188866_103578513300019095Freshwater LakeIAIAALLGLATAANKPEKTPAYNAWESVKDGAEDGKYERVVPAHFTADTDDIFMRSMVKKYAVEERTDTEELDDGTKIGGEPTGKFNMTQATALASAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFICSDQYMTLGESG
Ga0193153_102223713300019097MarineMRTLAIAALIGMVTCAQLKGDPTPPYNPWESVKDGAADGKYERVTTAHFSADSDDIFMRSMIGKYAVEARTDTETLDDGTKVGGEPTGKFWMTQSGTLAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMGFLASDQYMSLGESG
Ga0193153_102666713300019097MarineATSSIRGDPTPAYNAWESVKDGAKDGKYERVVTSHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGAFWMTEGNTLAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQSGKVEVIKMPQFMRFLCSDQYMQLGESG
Ga0193102_102464113300019099MarineKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0194243_100388023300019102MarineMKFLAIAALLGLAAAVEKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0194243_100504613300019102MarineTWGIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0194243_100731323300019102MarineADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0192946_104612513300019103MarineHGELIINLLQMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAASKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMTLGESG
Ga0192946_105055713300019103MarineLSGDPTPAYNAWESVKDGAKDGKYERVLTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESGXATRKXNEQNGKDFLKLL
Ga0192972_104749013300019108MarineLDEHSAVTKHVGQDSEGAAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0193541_105948313300019111MarineMKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193243_102972713300019116MarineMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLLP
Ga0193243_103840113300019116MarineMKTIAIAALLGLVASTKLNGDPTPAYNPWESVKGGAEEGKYERVVTSHFSADSDDIFMRSMISKYAQEARTDTETLDDGTKVGGEPTGKFWMNKASTLAASKEVLGTHKGLAGDALSAYLDTYYDKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193243_104379313300019116MarineAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193054_102546113300019117MarineMQAAEVSSGVILAETAQTMPTGLVEMSFKPEPTPPYNAWESVKDGAADGKYERVVTTHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193054_103914423300019117MarineMKYLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193054_104099413300019117MarineMKTIAFACLLGLTVATKLRGDPAPPYNAWESVKDGAQDGKYERVITPHFSADSDDIFMRSMIKKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGDGLSAYLDTYFKKAWDHFDVNQSGKIEVIKSPQFMRFLASDQYMDLGVSG
Ga0193054_104342313300019117MarineMKSIAIACLLGLVATVRIEDSEKTAPYNAWESVKDGAKDGKYERVVTANFSSDDDDIFMRSMIKKYAIEERTDTETLDDGTKVGGEPTGKFNMTQSTALAASKEVLGTHKGLSGDALAAYIDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLCSDQYMDLGVSG
Ga0193054_104473713300019117MarineTWGIIKLLKTTNESRCYRRPPRSHCCHKSTGDKTAPYNAWESVKDGAADGKYERVVTARFSADSDDIFMRSMITKYAVELRTDTEELDDGTKVGGEPTGKFMMTEANALAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVQQDGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0193054_107476213300019117MarineYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGAFWMTEANALAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLCSDQYMQLGESG
Ga0193157_102052513300019118MarineMKTIAIACLLGLAASVEIKGDPTPPYNAWESVKDGAEDGKYERVTTPHFSADSDDIFMRSMINKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLGAAKEVLATHKGLGGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMDLGVSG
Ga0193157_102173013300019118MarineMRAIVVACLLGLTVGIQKTESTAPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTTMAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNMGLGESG
Ga0193157_102560313300019118MarineGALLGLATCIRDSEKTAPYNAWESVKDGKEDGKYERVTTAHFSGDSDDIFMRSMINKYAQETRTDTETLDDGTKLGGEPTGKFIMTQSTALGAAKEVLATHKGLSGDALSAYLDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG
Ga0193157_102904113300019118MarineEKTSPYNAWESVKDGADDGKYERVVTSHFSADADDIFMRSMIKKYAQEERTDTETLDDGQKIGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGQIEVIKMPQFMRFLASDQYMSLGESG
Ga0193157_103407113300019118MarineGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTTMAAAKEVLNTHKGLAGDALAAYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQNMGLGESG
Ga0193256_106894413300019120MarinePEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0192980_106131913300019123MarineMKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESGXAXNEEMKKSLFXDYFKFIQILKESDGQSFRSKK
Ga0193104_103273723300019125MarineMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIAKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193104_104670313300019125MarineAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATALAAAKEVLGTHKGLSGDALASYVDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0193436_103795313300019129MarineMQTVEVSSGVILAETAQTMPTGLVEMSFKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193436_104183213300019129MarineMKFLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0193436_104425813300019129MarineMKYLAIAALLGLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193112_113313813300019136MarineKDGAADGKYERVVTSHFSADNDDIFMRSMISKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0193047_108573013300019139MarineFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0188870_1011155713300019149Freshwater LakeMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0188870_1011520613300019149Freshwater LakeQMRGIVIAALVGLAVAKVGKPEATAPYGAWESVKDGAEDGKYERIITPNFKGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALGAYIDTYFGKAWSHFDVNQTGEVEVTKMPQLMRFLASDQSLSLGESG
Ga0188870_1013599813300019149Freshwater LakeRTFAIAALLGLAATSKIQDPTPSYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAVEARTDTETLDDGTKVGGEPTGAFWMTQANTLAASKEVLNTHKGLSGDALAAYMDTYFVKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMTLGESG
Ga0194244_1004405323300019150MarineVKFLAIAALLGLAAAVEKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0194244_1004405623300019150MarineMKFLAIAALLGLAAAVEKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0194244_1004405723300019150MarineMKFLAIAALLGLAAAVEKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0194244_1004630513300019150MarineMKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0194244_1006180413300019150MarineMRAIVIACLLGLTVATKIRGDPTPPYNAWESVKDGASDGKYERVVTPHFSADSDDIFMRSMISKYAQEERTDTDVLDDGQKVGGEPTGKFWMTQATTLAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGSVEVIKMPQFMRFLASDQYMGLGESG
Ga0194244_1008101113300019150MarineSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGEALSAYLDTYFTKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYLSLGESG
Ga0182075_113404013300019282Salt MarshEKTPPYNAWESVKDGAEDGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTAKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0182044_115906813300020014Salt MarshAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGAVEVIKMPQFMRFICSDQYMSLGESG
Ga0206124_1022256113300020175SeawaterPLLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0211702_1008897813300020422MarineMKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTTHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0206695_111327113300021348SeawaterVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0206692_148370513300021350SeawaterNIMRAFVIAALLGLATCIRDSEKTPPYNAWESVKDGKEDGKYERVTTAHFSGDSDDIFMRSMINKYAQETRTDTETLDDGTKIGGEPTGKFWMTQSTSLAASKEVLKTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGSIDVIKMPQFMRFLCSDQYMTLGESG
Ga0206692_162776913300021350SeawaterMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTPHFSSDSDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQSLSLGESG
Ga0206692_173249513300021350SeawaterRTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIGKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0206693_132590413300021353SeawaterQMRAIAIACLLGLVAATRIQKTESTAPYNAWESVKDGKDDGKYERVITAHFSADADDIFMRSMISKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGQIEVIKMPQFMRFLASDQYMSLLP
Ga0206693_161372013300021353SeawaterMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0206693_176901213300021353SeawaterVIACLLGLAVGVRKTETTAPYNAWESVKDGAEDGKYERKVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQSTSLAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGQIEVIKMPQFMRFLASDQNMGLGESG
Ga0213865_1027810813300021373SeawaterAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0063111_11415713300021868MarineAVVIACLLGLAVGIKTSSDPAPPYNAWESVKDGAKDGKYERVVTPHFSADSDDIFMRSMIKKYAQEERTDTETLDDGTKVGGEPTGKFWMTQSTTLGAAKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMSLGESG
Ga0063132_10691313300021872MarineLAAAVEKPEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIAKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0063089_101728813300021889MarineKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0063089_104324613300021889MarineKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLDSYIDTYFDKAWAHFDVNKSGQVEVLKMPQFMRFICSDQRMSLNESG
Ga0063089_107596813300021889MarineKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0063093_103355213300021891MarineLAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0063120_106023813300021895MarineQMKTIAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGQKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALASYLDTYFAKAWAHFDVNQTGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0063136_100165513300021896MarineDMKTIAIAALFGLVSCSKLEGDPTPAYNAWESVKDGAEDGKYERVLPGYFSGDSDDIFMRSMIKKYAVEKRTDTETLDDGTKIGGEPTGTFMMTQSTALAASKEVLNTHKGLAGDALGAYLDTYFSKAWAHFDVNQTGSIEVIKMPQFMRFLCSDQYMQIGESG
Ga0063136_101278213300021896MarineMKTIAIAALLGLVTCTKLNGDPTPAYNAWESVKDGAENGKYERVITPHFSGDADDIFMRSMIKKYAVEERTDTETLDDGTKVGGEPTGKFMMTQSTALAASKEVLGTHKGLAGDALGAYLDTYFSKAWAHFDVNQKGAVEVIKMPQFMRFLASDQYMSLGESG
Ga0063144_105812613300021899MarineAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0063135_107492513300021908MarineIACLLGLAAAVEIHGDPTPPYNAWESVKDGAADGKYERVLTSHFSGDADDIFMRSMISKYAQELRTDTDKLDDGTKIGGEPTGKFVMNQASTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGAVEVIKMPQLMRFLASDQYMSLGESG
Ga0063133_101158213300021912MarineMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0063133_101254413300021912MarineKTIAIACLLGLATATKLSGDPTPAYNAWESVKDGSKDGKYERVVTAHFSGDSDDIFMRSMIGKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0063133_102072613300021912MarineAIACLLGLASSTKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDSDDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLAAAKEVLGTHKGLSGEALSAYLDTYFAKAWAHFDVNQGGKLEVIKMPQFMRFLASDQYMTLGESG
Ga0063133_104146913300021912MarineFALLALISVAAAKPEATDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGQVEVLKMPQFMRFICSDQRMSLGESG
Ga0063139_101415313300021934MarineMKTIAFAALIALVSASKTAPYNAWESVGGGAADGKYERVVTAHFAADTDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLSGDALGAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLCSDQYMQLGESG
Ga0063138_108721613300021935MarineFAIALLIAAVAAKPEPTPPYNAWESVKDGAEDGKYERVITPNFSGDADDIFMRSMIKKYAVEERTDSEELDDGTKIGGEPTGKFWMNQATSLAAAKEVLNTHKGLSGDALSAYLDTYFGKAWAHFDVNQTGEIEVTKMPQFMRFIASDQNLSLGESG
Ga0063102_102522213300021941MarineKYFALIALLSAVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLGSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG
Ga0063102_103128713300021941MarineKKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTAMPQFMRFVCSDQGMQLGESG
Ga0063101_100728613300021950MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG
Ga0063101_106544213300021950MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVAGGKDEGKYERKVPTHFGADNDDIFMRSMLTKYALEEKTPVKELDDGSKVGGEPTGKFWLDKEKARMAASEVLSTHKGLGGPALSSYLETYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0228692_10268513300023554SeawaterKFLAIAALLGLTAARQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEGRTDSQTLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQWMSLKESG
Ga0232113_102384013300023679SeawaterQMKFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0228681_103453613300023683SeawaterTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYM
Ga0228681_104071913300023683SeawaterTMRTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTTVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0228687_103371613300023696SeawaterQMRTIALLALLGVAAAIRDPTPAKNAWESVAGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTDTLDDGTKVGGEPTGKFWMTQANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMQLGESG
Ga0228682_104067013300023698SeawaterKFIMRTFAIAALIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0228682_104183413300023698SeawaterRTFAIAALIGLAACHKLEAATPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLEAYLNTYYQKAWDHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0228682_104497013300023698SeawaterKTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0228682_105113813300023698SeawaterLKYNAWESIPNGAVDGKYERVVTPNFSSDSDDIFMRSMITKYAFEKRTDLETLDDGSTVGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASDQGMPLGESG
Ga0228682_105883013300023698SeawaterGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0228685_105521813300023701SeawaterIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0228684_105686913300023704SeawaterCLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0209634_122847013300025138MarineATATKLSGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQAGTLSAAKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0209306_108982913300025680Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0209306_109581813300025680Pelagic MarinePKPQNPAHMILKYYYDCLLKKYRRNNRIIIIKKLQMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0209505_108656213300025690Pelagic MarineMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0209602_112114413300025704Pelagic MarineMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0209305_119149513300025712Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRM
Ga0209309_1044330013300025881Pelagic MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDV
Ga0247557_101875723300026403SeawaterRTFALAALLGLAVAIREQTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247557_103828713300026403SeawaterESTAPYNALESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTDPSRSSRCHSS
Ga0247581_106202013300026420SeawaterTDPYNAWESVKDGAEDGKYERVVTSHFSADDDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0247581_106391413300026420SeawaterALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247581_107936213300026420SeawaterTIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALTDYLDTYFDKAWENFDVNNDGAIEVIKSPMFMRFLCSDQGMQLGESG
Ga0247591_107897313300026434SeawaterIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNSHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247591_108708613300026434SeawaterMKSIVFAALLGLTVGIQKTEKTAPYQAWESVKDGAEDGKYERVVTANFKGDDDDIFMRSMIKKYAIEKRTDTEILDDGTKIGGEPTGKFMMTQATALAASKEVLNTHKGLSGDLLSAYIDTYFGKAWGHFDVNQTGEIEVIKMP
Ga0247607_107161013300026447SeawaterSILTMRTFALAALLGLAVAIRDPTAPYNAWESVADGAADGKYERVVTPNFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247607_107844813300026447SeawaterIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247607_108374813300026447SeawaterKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247607_108902513300026447SeawaterPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLEAYLNTYYQKAWDHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247607_109056813300026447SeawaterAIRDPTPAKNAWESVAGGAEDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTDTLDDGTKVGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247594_105318613300026448SeawaterKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0247594_105787913300026448SeawaterRTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0247594_105970413300026448SeawaterKTIAIAALIALVSAEATAPYNAWQSVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALTAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247594_106716213300026448SeawaterAALIGLAACHKLEATTPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLEAYLNTYYQKAWDHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247594_107640613300026448SeawaterSESDKVIEKHPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALTDYLDTYFDKAWENFDVNNDGAIEVIKSPMFMRFLCSDQGMQLGESG
Ga0247594_110014213300026448SeawaterKFIMRAFAIAALIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247593_110984113300026449SeawaterNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247578_111656813300026458SeawaterESVADGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247568_112027213300026462SeawaterKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247588_109270813300026465SeawaterIMRTFAIAALIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247588_109321013300026465SeawaterMKTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYM
Ga0247598_111855613300026466SeawaterRTIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247598_113892613300026466SeawaterGLAASITVEGDPTPPYNAWESVKDGGAEGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDMLSAYLDTYFAKAWEHFDVNKKGQIEVIKSPQFMRFLASDQFMSLGESG
Ga0247603_108945313300026468SeawaterLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0247603_109359013300026468SeawaterETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247603_112191313300026468SeawaterESIKDGAADGKYERIITPNFSSDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALSDYLDTYFDKAWSNFDVNNDGAIEVIKSPMFMRFLCSDQGMQLGESG
Ga0247599_111106613300026470SeawaterDGAADGKYERVVTPNFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTTVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247571_109001513300026495SeawaterNKQMKYAVLLALIAVVAAKPEKTDPYNAWESVKDGAEDGKYERVVTSHFSADDDDIFMRSMIKKYAQEERTDHEELDDGTKVGGEPTGKFMMNKASSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGAIEVIKMPQFMRFVASDQNMSLGESG
Ga0247571_109162013300026495SeawaterMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGTIEAVKMPQFMRFLASDQRLSLGEFF
Ga0247571_111768313300026495SeawaterIALVSAESTAPYNAWESVAGGAADGKYERVVTRNFSGYSDDLFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0247571_114314413300026495SeawaterTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG
Ga0247592_112381913300026500SeawaterMRTIAIACLLGLAASITVEGDPTPPYNAWESVKDGGAEGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDMLSAYLDTYFAKAWEHFDVNKKGQIEVIKSPQFMRFLASDQFMSLGESG
Ga0247592_114294813300026500SeawaterIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247592_114667613300026500SeawaterMRAIVIACLLGLSAAGKPEPTPPYNAWESVKDGASDGKYERIITPHFSGDADDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQSTTLAAAKEVLNTHKGLSGDMLSAYLDTYFAKAWAHFDVNQTGEIEVIKMPQFMRFLASDQYMQLGESG
Ga0247605_112323313300026503SeawaterAFTIACLLGLSAAVKLDFPAGPGTPVEQDPYNAWDSVKDGAANGQYERVITPHFSSDKDDIFMRSMIKKYAVEERTDKEMLADGEIIGGEPTGIFWITPKEARWASEEVLKTHKGLSGQMLEDYVNTYFQRTWDNFDVNKEGKIEVIKMPQFMRFLASDQFMSLGESG
Ga0247605_113362713300026503SeawaterTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247587_112668513300026504SeawaterHMRTIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247587_112717313300026504SeawaterKTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIGKYAVELRTDTETLDDGTTVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0247587_113162913300026504SeawaterRTIAIACLLGLAASITVEGDPTAPYNAWESVKDGGAEGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDMLSAYLDTYFAKAWEHFDVNKKGQIEVIKSPQFMRFLASDQFMSLGESG
Ga0247587_118116513300026504SeawaterSIVFAALLGLTVGIQKTEKTAPYQAWESVKDGAEDGKYERVVTANFKGDDDDIFMRSMIKKYAIEKRTDTEILDDGTKIGGEPTGKFMMTQATALAASKEVLNTHKGLSGDLLSAYIDTYFGKAWGHFDVNQTGEIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247590_115049213300026513SeawaterAPYNAWQSVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0247590_117684313300026513SeawaterNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0209710_115052913300027687MarineMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTKAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0209502_1023295413300027780MarineLKKYRGNNRIIIIKKLQMKYFALIALLSAVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLGSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG
Ga0209091_1023664613300027801MarineLKPLYSIIINNRFTMKFTLAIAALLSISSAMKLEKDYFQPWEHVAGGKDEGKYERKVPTHFGADNDDIFMRSMLTKYALEEKTPVKELDDGSKVGGEPTGKFWLDKEKARMAASEVLSTHKGLGGPALSSYLETYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0209092_1028591413300027833MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0209092_1049953213300027833MarineVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDLGYAAKEVLKDHKGLTGDKLSSYLDTYFDRAVENFDPNGDGAIEVIKAPMFMRFLASDQGMSLGENGEDAGEIASFNALRAKMADK
Ga0209092_1062249213300027833MarineKNPTYIAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDGSMQIGESG
Ga0247562_103098923300028076SeawaterAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0247586_107773413300028102SeawaterTIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRFIASDQGMSLGESG
Ga0247596_111682413300028106SeawaterLTMRTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0247596_111691313300028106SeawaterHMKTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247596_111798113300028106SeawaterRTFAIAALIGLAACHKLEATTPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLQAYLDTYYQKAWDHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247582_112616613300028109SeawaterKTIAIAALIALVSAESTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDLFMRSMISKYAVELRTDTETLDDGSTVGGEPTGKFMMGKGNAEAAAKEVLNTHKGLAGDALAAYMDTYFAKAWAHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG
Ga0247582_114188013300028109SeawaterQQMRTFAIAALIGLAACHKLEASTPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLEAYLNTYYQKAWDHFDVNQTGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0247582_115294713300028109SeawaterNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247584_114909113300028110SeawaterMKSIVFAALLGLTVGIQKTEKTAPYQAWESVKDGAEDGKYERVVTANFKGDDDDIFMRSMIKKYAIEKRTDTEILDDGTKIGGEPTGKFMMTQATALAASKEVLNTHKGLSGDLLSAYIDTYFGKAWGHFDVNQTGEIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247561_11460613300028119SeawaterLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0256411_120689113300028134SeawaterRTIAIACLLGLAASITVEGDPTPPYNAWESIKDGGAEGKYERVITPHFSADDDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDMLSAYLDTYFAKAWEHFDVNKKGQIEVIKSPQFMRFLASDQFMSLGESG
Ga0256412_124416013300028137SeawaterILTMRTIAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSMSLGESG
Ga0256412_124915613300028137SeawaterKNLQMKTFAIAALIGLVACTKLNGPTPAKNAWESVAGGADDGKYERVVTPNFSADSDDIFMRSMISKYAVEAMTDTDTLDDGTKVGGEPTGKFWMTQANALAAGKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0256412_125221113300028137SeawaterMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALASYMDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVASDQNMGLGESG
Ga0256412_126352913300028137SeawaterKYFALLALISVVAAKPEKTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG
Ga0256412_128353113300028137SeawaterQMRAFAIVALLVATASAGSDTKPTPPYGAWESVKDGAEDGKYERIITPHFSGDSDDIFMRSMIKKYAVEERTDTTTLDDGTKIGGEPTGKFWMNQGTALAAAKEVLNTHKGLAGEALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMQLGESG
Ga0256412_128359513300028137SeawaterTFAIAALIGLAASTKLTGPAPPFQAWNSVPDGKVDGKYERVITSRFSADDDDLFMRSMIKKYAVEERTDFDTKDDGEIVGGEPTGKFWMTQSTTLNAAKEVLKTHKGLNGFQLGNYLDTYFEKAWDHFDVTGVGQIEVSKMPQFMRFLASDQRMSLDESG
Ga0256412_128392713300028137SeawaterFAIAALIGLAACHKLEATTPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLEAYLNTYYQKAWDHFDVNQSGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0256412_128515313300028137SeawaterTIAIACLLGLATAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQEKRTDHEELDDGTKIGGEPTGKFIMTKSTSLAAAKEVLNTHKGLAGDALSAYIDTYFDKAWAHFDVNQDGEIDVIKMPQFMRCIASDQGMSLGESG
Ga0256412_128595913300028137SeawaterFLAIAALLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0256417_112349213300028233SeawaterSYLAIAALLGLAVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0256417_116705113300028233SeawaterIMKFTLAIAALLSLTSAMKLEKDYFQPWEHVADGKEEGKYERNIPKHFQADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKDKARQAAGEVLHTHKGLSGDALSSYLNTYFEKAWGHFDVNLTGTIEVIKMPQFMRFLCSDQYMQLGESG
Ga0256417_117702913300028233SeawaterMRAIVIACLLGLSAAGKPEPTPPYNAWESVKDGATDGKYERIITPNFSGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVIKMPQFMRFLASDQFMSLGESG
Ga0256413_124469113300028282SeawaterAIAALIALVSAETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMISKYAVELRTDIETLDDGTSVGGEPTGKFMMTQANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0256413_124592213300028282SeawaterFALLALISVVAAKPEKTDPYNAWDSIKDCAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKATTAAAAKEVLNTHKGLSGEMLDSYMDTYFDKAWAHFDVNKSGEIEVLKMPQFMRFICSDQRMSLGESG
Ga0256413_126887113300028282SeawaterRTFAIAALIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0256413_127145613300028282SeawaterFAIAALIGLAACHKLEGSTPPYNAWDSIKGGAEEGKYERVLTPHFSADTDDIFMRSMLTKYAQESRTDTETLDDGKVVGGEPTGKFWMTQATTLAAAKEVLATHKGLKGEMLQAYLDTYYQKAWDHFDVNQSGSIEVIKMPQFMRFLASDQYMQLGESG
Ga0256413_128415213300028282SeawaterAIAALIASVSAVTLNKPEATAPYQAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKNYAVEERTDHEELDDGTKVGGEPTGKFMMTKSTTMAATKEVLNTHKGLSGDALASYMDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFVASDQNMGLGESG
Ga0256413_129050513300028282SeawaterQMRAFAIVALLVATASAGSDTKPTPPYGAWESVKDGAEDGKYERIITPHFSGDSDDIFMRSMIKKYAVEERTDTTTLKDGTEIGGEPTGKFWMNQATALAASKEVLNTHKGLAGEALSAYLDTYFSKAWAHFDVNQTGEIEVIKMPQFMRFLASDQNLSLGESG
Ga0256413_131013913300028282SeawaterWESVKDGAADDKYERIITPNFSSDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALTDYLDTYFDKAWENFDVNNDGAIEVIKSPMFMRFLCSDQGMQLGESG
Ga0256413_134514113300028282SeawaterLEAMGPIYNAWESIAGGAAEGKYERVVTPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWENFDVNGAGSVEVIKAPQFMRFLASDQTFDLGV
Ga0247572_112018313300028290SeawaterQMKYAVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0247572_117370513300028290SeawaterTFAIAALIGLVAATKLNTAPYNAWDSIAGGAAEGKYERVITPHFSTDTDDLFMRSMITKYAQEERTDKETLDDGAIIGGEPTGKFWMTQKTMYNAAKEVLATHKGLTGDAQKAYLDTYFDKAWENFDVNGAGQVEVIVSPQFMRFLCSDQRMALGEA
Ga0247601_104119413300028330SeawaterLLGLTAAVQKPEATAPYNAWESVKDGAADGKYERVVTSHFSADSHDIFIRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAASKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0247597_103884113300028334SeawaterVLLALVAVVAAKPEKTDPYNAWESVKDGAEDGKYERVITAHFSADDDDIFMRSMIKKYAVEERTDHEELDDGTKVGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKDGSIEVIKMPQFMRFICSDQNMSLGESG
Ga0247597_105165113300028334SeawaterETTAPYNAWESVAGGAADGKYERVVTPNFSGDSDDIFMRSMIGKYAVELRTDTETLDDGTSVGGEPTGKFMMTEANTKAAAKEVLNTHKGLSGDALAAYMDTYFAKAWAHFDVNQGGSVEVIKMPQFMRFLASDQSLSLGESG
Ga0304731_1066565713300028575MarineMKAIAIAALLGLTVAIQKTEPTAPYNAWESVKDGAEDGKYERVVTAHFSSDSDDIFMRSMIKKYAQEERTDTETLDDGTKIGGEPTGKFWMTQGTSMAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQNMGLGESG
Ga0304731_1070511613300028575MarineMKAAVIALFLGLAVAIKSQDSEKTPPYNAWESVKDGAADGKYERVATAHFSGDGDDIFMRSMITKYAVELRTDTETLDDGTKVGGEPTGKFMMTEANALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGSIEVIKMPQFCRFLASDQSLSLGESG
Ga0304731_1084626613300028575MarineEQMRTIAIACLLGLAVAIKKPEPTPPYNAWESVKDGAEDGHYERVITSHFSGDSDDIFMRSMIKKYAVEERTDSDELDDGTKIGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFIASDQNMQLGESG
Ga0304731_1093028513300028575MarineAASVEIKGDPTPPYNAWESVKDGAEDGKYERVTTPHFSADSDDIFMRSMINKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQSTTLNAAKEVLATHKGLGGQALADYLDTYFAKAWAHFDVNQSGQIEVIKSPQFMRFLASDQYMDLGVSG
Ga0304731_1161316713300028575MarineMRTIAIACLLGLTVAIQKPEKTAPYNAWESVKDGAEDGKYERVVTANFAGDADDIFMRSMIKKYAQEERTDHEELDDGTKIGGEPTGKFIMTKGTSLAAAKEVLNTHKGLSGDALSAYLDTYFDKAWAHFDVNQGGSLDVIKMPQFMRFLASDQSMSLGESG
Ga0304731_1162333113300028575MarineWESVKDGAEDGKYERVVTPNFSGDADDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQTGEVEVTKMPQLMRFLASDQNLSLGESG
Ga0257128_108497613300028672MarineKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGETLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG
Ga0257128_110700713300028672MarineTDPYNAWDSIKDGAEDGKYERQVTAHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLSSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG
Ga0307401_1049577713300030670MarineIMKFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307403_1055583113300030671MarineGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0307403_1059656513300030671MarineMKFTLTIAAILSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMLQFMRFICSDQYMQLGESG
Ga0307398_1062964913300030699MarineIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307400_1077140813300030709MarineFIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAGAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0308127_103279113300030715MarineAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG
Ga0308139_105795513300030720MarineLVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG
Ga0308133_105202313300030721MarineAALLSISSAMKLEKDYFQPWEHVAGGKDEGKYERKVPTHFGADNDDIFMRSMLTKYALEEKTPVKELDDGSKVGGEPTGKFWLDKEKARMAASEVLSTHKGLGGPALSSYLETYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0308133_105505113300030721MarineLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTAMPQFMRFVCSDQGMQLGESG
Ga0073988_1228265613300030780MarineMKTIAIACLLGFVAAAPEPTAPYNAWESVKDGAEDGKYERVVTPHFSADSDDIFMRSMITKYAVEERTDHDTLDDGTKVGGEPTGKFWMTQSTALAASKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQYMSLAESG
Ga0073988_1232528713300030780MarineNKQMKFLAIAALLGLTVAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDLEVIKMPQFMRFLASDQYMSLGESG
Ga0073988_1234682713300030780MarineTIAIACLLGLAASMTVEGDPTPPYNAWESVKDGAEDGKYERVITAHFSADSDDIFMRSMIKKYAVEERTDHDVLDDGTKVGGEPTGKFWMTQATTMAAAKEVLATHKGLSGQALADYLDTYFAKAWAHFDVNQTGQIEVIKSPQFMRFLASDQYMTLGESG
Ga0073982_1000662613300030781MarineTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGGALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073966_1167386213300030786MarineWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073990_1000522413300030856MarineNLIKQMRTIAFLALIGVAVAIRGDPTPPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMISKYAVEARTDTETLDDGTKVGGEPTGKFWMTQSNALAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0073990_1000984023300030856MarineDGKYERVVTAHFSADSDDIFMRSMISKYAVEAMTDTETLDDGTKVGGEPTGKFWMTQANALAAAKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQSGKIEVIKMPQFCRFLASDQYMTLGESG
Ga0073990_1001456613300030856MarineKQMKFLAIAALLGLAAAVQKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0073990_1001778213300030856MarineNKQMKFLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073990_1197974313300030856MarineVIAALFALTAAKVGKPEATPPYNAWESVKDGAEDGKYERIVTPHFSSDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALNAYLDTYFAKAWAHFDVNQSGEVEVIKMPQFMRFLASDQSLSLGESG
Ga0073981_1164708413300030857MarineIACLLGLVAAIQKPEKTAPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMIKKYAQEERTDHEELDDGTKIGGEPTGKFMMTKGTSLAAAKEVLNTHKGLAGDALQAYLDTYFDKAWSHFDVNMDGAIDVIKMPQFMRFLASDQGMSLGESG
Ga0073981_1170008613300030857MarineAALLGLTVAIKSTGDKTAPYNAWESVKDGAADGKYERVVTPRFSADSDDIFMRSMISKYAVELRTDTEELDDGTKVGGEPTGKFMMTEANALAASKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVQQDGKIDVIKMPQFMRFLASDQSLSLGESG
Ga0073981_1170020813300030857MarineIAIAALLGLAAGIQKTEPTAPYNAWESVKDGAEDGKYERKVTAHFSADADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQYMSLGESG
Ga0073981_1171716113300030857MarineLQMKTIAIACLLGLATATKLTGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAASKEVLGTHKGLSGDALAAYLDTYFAKAWAHFDVNQTGKIEVIKMPQFMRFLASDQYMSLGESG
Ga0073981_1171723213300030857MarineLQMKTIAIACLLGLATATKLNGDPTPAYNAWESVKDGAKDGKYERVVTAHFSGDADDIFMRSMISKYAVEERTDTETLDDGTKVGGEPTGKFNMTQATTLAAAKEVLGTHKGLAGDALAAYLDTYFAKAWAHFDVNQTGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0151492_106236713300030869MarineILAETAQTMPTGLVEVSFGDPTPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMITKYAQEERTDTEVLPNGMRIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073938_1206387913300030952MarineRTIAIACLLGLATAITKPEKTAPYNAWESVKDGAEDGKYERVVTANFASDSDDIFMRSMIKKYAQELRTDHEELDDGTKIGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALSAYLDTYFDKAWAHFDVNQDGSIDVIKMPQFMRFIASDQGMSLGESG
Ga0073976_1161244813300030957MarinePTGLVEVSFGDPTPPYNAWESVKDGAADGKYERVVTAHFSADSDDIFMRSMITKYAQEERTDTEVLPNGMRIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQSGKVEVIKMPQFMRFLASDQYMSLGESG
Ga0073984_1000203313300031004MarineMRTIAIACLLGLAVAINKPEKTPPYNAWDSVKDGAEDGKYERVVTANFSSDSDDIFMRSMITKYAQEKRTDTDELDDGTKIGGEPTGKFIMTQSTSLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGAIDVIKMPQFMRFLCSDQSMQLGESG
Ga0073984_1129013113300031004MarineNKQMKFLAIAALLGLAAAVEKPEPTPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0073980_1137445113300031032MarinePTPPYNAWESVKDGAADGKYERVTTAHFSADSDDIFMRSMIGKYAQELRTDTEKLDDGTKIGGEPTGKFVMNQANTLAAAKEVLGTHKGLSGDALGAYLDTYFAKAWAHFDVNQTGAVEVIKMPQFMRFLASDQYMSLGESG
Ga0073979_1245457713300031037MarineEATPPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073986_1001696413300031038MarineLAIAALLGLAAAVQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073986_1199161413300031038MarinePYNAWESVKDGAEDGKYERKVTAHFSGDADDIFMRSMITKYAQEERTDTETLDDGTKIGGEPTGKFWMTQATTLAAAKEVLNTHKGLSGDALSAYLDTYFAKAWAHFDVNQTGQVEVIKMPQLMRFLASDQNLSLGESG
Ga0073986_1204166713300031038MarineQKPEATPPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFLASDQYMSLGESG
Ga0138346_1033881513300031056MarineMKFLAIAALLGLAAAVQKPEPTAPYNAWESVKDGAADGKYERVVTSHFSADNDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0073989_1352204613300031062MarineQLQMKTIAFAALIGLTVATKLRGDPAPPYNAWESVKDGAEDGKYERVVTPHFSADSDDIFMRSMIKKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTTLAAAKEVLATHKGLSGDALSAYLDTYFKKAWDHFDVNQSGKIEVIKSPQFMRFLASDQYMGLGESG
Ga0073989_1359047713300031062MarineAIQKPEKTAPYNAWESVKDGAEDGKYERVVTSHFSGDADDIFMRSMIKKYAQELRTDHEELDDGTKIGGEPTGKFMMTKGTSLAAAKEVLNTHKGLSGDALSAYLDTYFDKAWSHFDVNMEGSIDVIKMPQFMRFLASDQGMSLGESG
Ga0073989_1359647613300031062MarineMRTIAFAALIALVSATKMRGDPTPAYNAWESVADGAKDGKYERVVTPHFSADSDDIFMRSMIKKYAVEARTDTETLDDGTKVGGEPTGAFWMTQANALAASKEVLNTHKGLSGDALAAYLDTYFAKAWAHFDVNQGGKIEVIKMPQFMRFLCSDQYMQLGESG
Ga0073989_1359822113300031062MarineIALAALIGVTVAIQKPEKTAPYNAWESVKDGAEDGKYERVITAHFSGDSDDIFMRSMIKKYAVELRTDTETLDDGTKIGGEPTGKFMMTEANALAAAKEVLNTHKGLAGDALSAYLDTYFAKAWAHFDVNQDGKIDVIKMPQFCRFLASDQSLSLGESG
Ga0138347_1132085113300031113MarineVFDDLSTYYARVTPTRFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0138345_1036464313300031121MarineEKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFLASDQGMSLGESA
Ga0307388_1089625913300031522MarineMKFTLAIAALLSISSAIKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0308143_12389613300031540MarineIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0308149_103827913300031542MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGEMLGSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG
Ga0308148_104439313300031557MarineSVKDGAEDGKYERKSTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTAMPQFMRFVCSDQGMQLGESG
Ga0308134_110539713300031579MarineKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFVCSDQYMSLGESG
Ga0308134_110823913300031579MarineTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTKAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0308134_111107913300031579MarineFALIALLSAVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLGSYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLNESG
Ga0308134_112714413300031579MarineLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYLEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0308134_114720113300031579MarineCLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTAMPQFMRFVCSDQGMQLGESG
Ga0308134_116435813300031579MarineFTLAIAALLSISSAMKLEKDYFQPWEHVAGGKDEGKYERKVPTHFGADNDDIFMRSMLTKYALEEKTPVKELDDGSKVGGEPTGKFWLDKEKARMAASEVLSTHKGLGGPALSSYLETYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0302131_129007013300031594MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNL
Ga0302126_1022393713300031622MarineMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDTLASYVDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMQLGESG
Ga0307393_116129313300031674MarineMKFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFSADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307386_1079619913300031710MarineMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307396_1045453813300031717MarineTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0307381_1025281813300031725MarineGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0307381_1040432513300031725MarineQMRAIVIAALFGLAASKVGKPEETPPYNAWESVKDGAEDGKYERAVTPHFSGDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGDALGAYLDTYFAKAWAHFDVNQTGEVEVIKMPQLMRFLASDQNLSLGESG
Ga0307391_1060066913300031729MarineKFFAIAALLGLTTAGDPTAPYNAWDSVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGASKEVLNTHKGLSGPALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSIGESG
Ga0307391_1092427713300031729MarineIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGADNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAGAALSSYLDTYFEKSWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307397_1044662213300031734MarineMKFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFSADNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307383_1040503613300031739MarineQMRAIVIAALFGLAASKVGKPEETAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0307383_1055254113300031739MarineQMRAIVIAALFGLAASKVGKPEETPPYNAWESVKDGAEDGKYERAVTPHFSGDSDDIFMRSMIKKYAVEARTDTTELEDGTKIGGEPTGKFWMTQSTTLAAAKEVLNTHKGLAGEALGAYLDTYFAKAWAHFDVNQTGEIEVIKMPQVMRFLASDQNLSLGESG
Ga0307395_1055788413300031742MarineFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFSADNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAAALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0307382_1036548313300031743MarineKFFAIAALLGLAAAGPEPTAPYNAWESVKDGAADGKYERVVTSHFSADSDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFWMTKSTTLGAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0307389_1096277713300031750MarineFIMKFTLAIAALLSISSAMKLEDYFQPWEHVAGGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKVGGEPTGKFWLDKDKARMAASEVLGTHKGLAAGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0315330_1052163423300032047SeawaterMKTIAIACLLGFVAAGDPAAPYNAWESVKDGAEDGKYERVVTAHFSADSDDIFMRSMITKYAVEERTDTDTLDDGTKVGGEPTGKFWMTQSTSLAAAKEVLNTHKGLSGDLLSAYLDTYFAKAWAHFDVNQTGQIEVIKMPQFMRFLASDQYMSLAESG
Ga0314670_1068060613300032470SeawaterIGGEPTGKFMMTKSTSLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314668_1044397113300032481SeawaterLSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314688_1063784213300032517SeawaterKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314689_1052067613300032518SeawaterKQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314689_1055249513300032518SeawaterIMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0314689_1064730013300032518SeawaterAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314676_1048945613300032519SeawaterTGTIEVIKMPQFMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314676_1073785813300032519SeawaterYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0314680_1074171913300032521SeawaterKYLSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314680_1076403613300032521SeawaterQKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314680_1089173413300032521SeawaterMKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAASSEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0314677_1043341613300032522SeawaterMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMSLGESG
Ga0314682_1058142313300032540SeawaterVVVVLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314683_1047322813300032617SeawaterMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314683_1069800113300032617SeawaterKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314683_1081540013300032617SeawaterTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0314673_1045023813300032650SeawaterMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314673_1058092313300032650SeawaterKVIEKNPTYNAWESVKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTSIEELDDGTKLGGEPTGVFMMGKKDMFRASKEVMGTHKGLSGDALSSYLDTYFDKAWENFDVNSDGAIEVIKAPQFMRFLASDQSLQLGESG
Ga0314685_1065792113300032651SeawaterPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0314678_1043383613300032666SeawaterKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0314678_1046107713300032666SeawaterVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314681_1052609813300032711SeawaterYLSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314681_1053404313300032711SeawaterKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFLCSDQRMSLGESG
Ga0314690_1044454713300032713SeawaterKQMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314703_1037495713300032723SeawaterPKYLSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314693_1068902913300032727SeawaterNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG
Ga0314699_1047840913300032730SeawaterMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0314699_1047909213300032730SeawaterQMRAIVIAAFLGLAASKVGKPEPTAPYGAWESVKDGAEDGKYERIITPNFKGDSDDIFMRSMIKKYAVEERTDTTELEDGTKIGGEPTGKFWMNQATTLAAAKEVLNTHKGLAGDALGAYLDTYFAKAWAHFDVNQTGEVEVIKMPQLMRFLSSDQSLSLGESG
Ga0314699_1048783713300032730SeawaterGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314711_1068777613300032732SeawaterMKYFVLIALLSVVAAKPESTDPYNAWDSIKDGAEDGKYERVVTSHFSSDSDDIFMRSMIKKYAVEERTDHETLDDGQKVGGEPTGLFWMTKSTTLNAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314714_1068590413300032733SeawaterKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKSGQIEVLKMPQFMRFICSDQRMSLGESG
Ga0314714_1077460113300032733SeawaterQKMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314706_1043502813300032734SeawaterMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVENRTDSETLDDGTKIGGEPTGKFMMTKSTTLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314710_1030903213300032742SeawaterSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314705_1055983013300032744SeawaterAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGEMLASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRFICSDQYMSLGESG
Ga0314712_1041770313300032747SeawaterAPKYLSIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKEEGKYERVIPKHFGADNDDIFMRSMLKKYSLEEKTPVKELDDGTKVGGEPTGRFWLDKEKARMAASEVLSTHKGLAGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG
Ga0314713_1042661513300032748SeawaterMRAIAIACLLGLAAAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKATTLSAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314708_1063183713300032750SeawaterMKYAVFLALVAVVAAKPEATAPYNAWESVKDGAEDGKYERVITNNFSTDGDDIFMRSMIKKYAVEERTDSETLDDGTKIGGEPTGKFMMTKSTSLAAAKEVLNTHKGLSGDALASYIDTYFDKAWAHFDVNKGGDVEVIKMPQFMRVLCSDQYMSLGE
Ga0314694_1050177313300032751SeawaterPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0314700_1048164713300032752SeawaterVSRSFTNFSAEFWSCKFTLAIAALLSITSAVKVNDYFQPWEHVADGKAEGKYERVIPKHFSADSDDLFMRSMLKKYALEEKTKVKELDDGTKVGGEPTGKFWLDKEKTRAAASEVLGTHKGLSGGALSSYLDTYFEKAWGHFDVNLTGTIEVIKLPQFMRFICSDQYMQLGESA
Ga0314700_1071048813300032752SeawaterAIAIACLLGLASAITKPEKTDPYNAWDSVKDGAEDGKYERKTTGHFSSDADDIFMRSMIEKYAKEARTDTEKLDDGTKIGGEPTGKFFMTKSTTLAAAKEVLNTHKGLSGPALGSYMDTYFEKAWAHFDVNQEGEVAVTMMPQFMRFVCSDQGMQLGESG
Ga0307390_1079562013300033572MarineIMKFTLAIAALLSISSAMKLEKDYFQPWEHVADGKDEGKYERVIPKHFGGDNDDIFMRSMLKKYALEEKTPVKELDDGTKIGGEPTGKFWLDKDKARMAASEVLGTHKGLAGAALSSYLDTYFEKSWGHFDVNLTGTIEVIKMPQFMRFICSDQYMQLGESG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.