Basic Information | |
---|---|
Family ID | F002340 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 569 |
Average Sequence Length | 39 residues |
Representative Sequence | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDHN |
Number of Associated Samples | 136 |
Number of Associated Scaffolds | 504 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.64 % |
% of genes near scaffold ends (potentially truncated) | 17.75 % |
% of genes from short scaffolds (< 2000 bps) | 72.76 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.603 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.508 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.112 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.276 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 504 Family Scaffolds |
---|---|---|
PF00196 | GerE | 2.78 |
PF12770 | CHAT | 2.38 |
PF14333 | DUF4389 | 1.98 |
PF00501 | AMP-binding | 1.19 |
PF06808 | DctM | 1.19 |
PF04519 | Bactofilin | 1.19 |
PF06463 | Mob_synth_C | 1.19 |
PF04392 | ABC_sub_bind | 1.19 |
PF04055 | Radical_SAM | 0.99 |
PF02515 | CoA_transf_3 | 0.99 |
PF11695 | DUF3291 | 0.99 |
PF03401 | TctC | 0.79 |
PF00589 | Phage_integrase | 0.79 |
PF01494 | FAD_binding_3 | 0.60 |
PF13193 | AMP-binding_C | 0.60 |
PF13924 | Lipocalin_5 | 0.60 |
PF00072 | Response_reg | 0.60 |
PF00106 | adh_short | 0.60 |
PF01979 | Amidohydro_1 | 0.40 |
PF13545 | HTH_Crp_2 | 0.40 |
PF05988 | DUF899 | 0.40 |
PF03492 | Methyltransf_7 | 0.40 |
PF13546 | DDE_5 | 0.40 |
PF07045 | DUF1330 | 0.40 |
PF05199 | GMC_oxred_C | 0.40 |
PF04290 | DctQ | 0.40 |
PF01565 | FAD_binding_4 | 0.40 |
PF00528 | BPD_transp_1 | 0.40 |
PF00239 | Resolvase | 0.40 |
PF13181 | TPR_8 | 0.40 |
PF13424 | TPR_12 | 0.40 |
PF08447 | PAS_3 | 0.40 |
PF00496 | SBP_bac_5 | 0.40 |
PF03781 | FGE-sulfatase | 0.40 |
PF04226 | Transgly_assoc | 0.40 |
PF13751 | DDE_Tnp_1_6 | 0.40 |
PF07366 | SnoaL | 0.40 |
PF00211 | Guanylate_cyc | 0.20 |
PF02668 | TauD | 0.20 |
PF00005 | ABC_tran | 0.20 |
PF02979 | NHase_alpha | 0.20 |
PF13428 | TPR_14 | 0.20 |
PF03070 | TENA_THI-4 | 0.20 |
PF12681 | Glyoxalase_2 | 0.20 |
PF02518 | HATPase_c | 0.20 |
PF03972 | MmgE_PrpD | 0.20 |
PF13367 | PrsW-protease | 0.20 |
PF01548 | DEDD_Tnp_IS110 | 0.20 |
PF00441 | Acyl-CoA_dh_1 | 0.20 |
PF01266 | DAO | 0.20 |
PF13231 | PMT_2 | 0.20 |
PF00561 | Abhydrolase_1 | 0.20 |
PF13426 | PAS_9 | 0.20 |
PF12399 | BCA_ABC_TP_C | 0.20 |
PF05226 | CHASE2 | 0.20 |
PF00042 | Globin | 0.20 |
PF14319 | Zn_Tnp_IS91 | 0.20 |
PF00596 | Aldolase_II | 0.20 |
PF07364 | DUF1485 | 0.20 |
PF00270 | DEAD | 0.20 |
PF03232 | COQ7 | 0.20 |
PF12706 | Lactamase_B_2 | 0.20 |
PF13671 | AAA_33 | 0.20 |
PF03600 | CitMHS | 0.20 |
PF04828 | GFA | 0.20 |
PF02082 | Rrf2 | 0.20 |
PF05231 | MASE1 | 0.20 |
PF12697 | Abhydrolase_6 | 0.20 |
PF13188 | PAS_8 | 0.20 |
PF06826 | Asp-Al_Ex | 0.20 |
PF00941 | FAD_binding_5 | 0.20 |
PF02585 | PIG-L | 0.20 |
PF13458 | Peripla_BP_6 | 0.20 |
PF13432 | TPR_16 | 0.20 |
PF14833 | NAD_binding_11 | 0.20 |
PF00583 | Acetyltransf_1 | 0.20 |
PF03129 | HGTP_anticodon | 0.20 |
PF07859 | Abhydrolase_3 | 0.20 |
PF11578 | DUF3237 | 0.20 |
PF00903 | Glyoxalase | 0.20 |
PF01546 | Peptidase_M20 | 0.20 |
PF07681 | DoxX | 0.20 |
PF00080 | Sod_Cu | 0.20 |
PF13620 | CarboxypepD_reg | 0.20 |
PF04972 | BON | 0.20 |
PF13360 | PQQ_2 | 0.20 |
PF04986 | Y2_Tnp | 0.20 |
PF12728 | HTH_17 | 0.20 |
PF07536 | HWE_HK | 0.20 |
PF14031 | D-ser_dehydrat | 0.20 |
PF13361 | UvrD_C | 0.20 |
PF11775 | CobT_C | 0.20 |
PF02096 | 60KD_IMP | 0.20 |
PF01547 | SBP_bac_1 | 0.20 |
PF07298 | NnrU | 0.20 |
PF12904 | Collagen_bind_2 | 0.20 |
PF13676 | TIR_2 | 0.20 |
PF07690 | MFS_1 | 0.20 |
PF13442 | Cytochrome_CBB3 | 0.20 |
PF03928 | HbpS-like | 0.20 |
PF12833 | HTH_18 | 0.20 |
PF13495 | Phage_int_SAM_4 | 0.20 |
PF13185 | GAF_2 | 0.20 |
PF12802 | MarR_2 | 0.20 |
PF01478 | Peptidase_A24 | 0.20 |
PF03779 | SPW | 0.20 |
PF01243 | Putative_PNPOx | 0.20 |
PF00656 | Peptidase_C14 | 0.20 |
PF02673 | BacA | 0.20 |
PF01554 | MatE | 0.20 |
PF03328 | HpcH_HpaI | 0.20 |
PF12860 | PAS_7 | 0.20 |
PF00296 | Bac_luciferase | 0.20 |
PF00202 | Aminotran_3 | 0.20 |
PF12395 | DUF3658 | 0.20 |
PF02913 | FAD-oxidase_C | 0.20 |
PF03466 | LysR_substrate | 0.20 |
PF00702 | Hydrolase | 0.20 |
PF01925 | TauE | 0.20 |
PF08238 | Sel1 | 0.20 |
PF09334 | tRNA-synt_1g | 0.20 |
PF14492 | EFG_III | 0.20 |
PF05139 | Erythro_esteras | 0.20 |
PF13472 | Lipase_GDSL_2 | 0.20 |
PF03480 | DctP | 0.20 |
PF00156 | Pribosyltran | 0.20 |
PF01522 | Polysacc_deac_1 | 0.20 |
PF01406 | tRNA-synt_1e | 0.20 |
COG ID | Name | Functional Category | % Frequency in 504 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.19 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.19 |
COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 1.19 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.19 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.99 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.79 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.60 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.60 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.60 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.40 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.40 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.40 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.40 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.40 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.40 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.40 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.40 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.40 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.20 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.20 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.20 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.20 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.20 |
COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.20 |
COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.20 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.20 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.20 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.20 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.20 |
COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.20 |
COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.20 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.20 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.20 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.20 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.20 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.20 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.20 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.20 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.20 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.20 |
COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.20 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.20 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.20 |
COG2941 | Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis) | Coenzyme transport and metabolism [H] | 0.20 |
COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.20 |
COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.20 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.20 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.20 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.20 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.20 |
COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.20 |
COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.20 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.20 |
COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.20 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.20 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.20 |
COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.20 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.78 % |
Unclassified | root | N/A | 46.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_13262400 | Not Available | 545 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100343575 | Not Available | 671 | Open in IMG/M |
3300000550|F24TB_10070305 | Not Available | 803 | Open in IMG/M |
3300000550|F24TB_11817900 | Not Available | 855 | Open in IMG/M |
3300000787|JGI11643J11755_10693538 | Not Available | 605 | Open in IMG/M |
3300000858|JGI10213J12805_10006612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
3300000858|JGI10213J12805_10006612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
3300000858|JGI10213J12805_10222683 | Not Available | 565 | Open in IMG/M |
3300000858|JGI10213J12805_10782974 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300000858|JGI10213J12805_10782974 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300000858|JGI10213J12805_11558494 | Not Available | 556 | Open in IMG/M |
3300001431|F14TB_101152806 | Not Available | 622 | Open in IMG/M |
3300001431|F14TB_101466494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1414 | Open in IMG/M |
3300001431|F14TB_101758272 | Not Available | 887 | Open in IMG/M |
3300003659|JGI25404J52841_10101905 | Not Available | 602 | Open in IMG/M |
3300003725|Ga0008087_108360 | Not Available | 610 | Open in IMG/M |
3300003725|Ga0008087_108360 | Not Available | 610 | Open in IMG/M |
3300004268|Ga0066398_10196391 | Not Available | 530 | Open in IMG/M |
3300004281|Ga0066397_10008223 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300004281|Ga0066397_10074263 | Not Available | 666 | Open in IMG/M |
3300004281|Ga0066397_10074263 | Not Available | 666 | Open in IMG/M |
3300004479|Ga0062595_100033986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2139 | Open in IMG/M |
3300004479|Ga0062595_100045164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1964 | Open in IMG/M |
3300005093|Ga0062594_100591611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 969 | Open in IMG/M |
3300005332|Ga0066388_100037017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 4736 | Open in IMG/M |
3300005332|Ga0066388_100057716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4073 | Open in IMG/M |
3300005332|Ga0066388_100462456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1909 | Open in IMG/M |
3300005332|Ga0066388_100737708 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300005332|Ga0066388_101017711 | Not Available | 1390 | Open in IMG/M |
3300005332|Ga0066388_102566672 | Not Available | 927 | Open in IMG/M |
3300005332|Ga0066388_103697723 | Not Available | 781 | Open in IMG/M |
3300005332|Ga0066388_103867629 | Not Available | 764 | Open in IMG/M |
3300005332|Ga0066388_105818584 | Not Available | 623 | Open in IMG/M |
3300005332|Ga0066388_106764392 | Not Available | 577 | Open in IMG/M |
3300005334|Ga0068869_101223632 | Not Available | 661 | Open in IMG/M |
3300005455|Ga0070663_100302383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1281 | Open in IMG/M |
3300005536|Ga0070697_100525962 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005545|Ga0070695_100011311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5338 | Open in IMG/M |
3300005549|Ga0070704_100741440 | Not Available | 874 | Open in IMG/M |
3300005713|Ga0066905_100000836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9609 | Open in IMG/M |
3300005713|Ga0066905_100003435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6230 | Open in IMG/M |
3300005713|Ga0066905_100007740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 4835 | Open in IMG/M |
3300005713|Ga0066905_100010599 | All Organisms → cellular organisms → Bacteria | 4357 | Open in IMG/M |
3300005713|Ga0066905_100010599 | All Organisms → cellular organisms → Bacteria | 4357 | Open in IMG/M |
3300005713|Ga0066905_100022049 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
3300005713|Ga0066905_100022049 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
3300005713|Ga0066905_100032908 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
3300005713|Ga0066905_100035361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2893 | Open in IMG/M |
3300005713|Ga0066905_100048214 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300005713|Ga0066905_100048214 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300005713|Ga0066905_100065615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2308 | Open in IMG/M |
3300005713|Ga0066905_100066301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2299 | Open in IMG/M |
3300005713|Ga0066905_100072363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2225 | Open in IMG/M |
3300005713|Ga0066905_100084847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2095 | Open in IMG/M |
3300005713|Ga0066905_100098488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1978 | Open in IMG/M |
3300005713|Ga0066905_100099282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1972 | Open in IMG/M |
3300005713|Ga0066905_100100621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1961 | Open in IMG/M |
3300005713|Ga0066905_100104374 | Not Available | 1933 | Open in IMG/M |
3300005713|Ga0066905_100112382 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300005713|Ga0066905_100121617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 1823 | Open in IMG/M |
3300005713|Ga0066905_100133829 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
3300005713|Ga0066905_100133898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1755 | Open in IMG/M |
3300005713|Ga0066905_100133898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1755 | Open in IMG/M |
3300005713|Ga0066905_100135361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 1748 | Open in IMG/M |
3300005713|Ga0066905_100141123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1719 | Open in IMG/M |
3300005713|Ga0066905_100168893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1599 | Open in IMG/M |
3300005713|Ga0066905_100174023 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300005713|Ga0066905_100212188 | Not Available | 1457 | Open in IMG/M |
3300005713|Ga0066905_100213455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
3300005713|Ga0066905_100230459 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300005713|Ga0066905_100239752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1385 | Open in IMG/M |
3300005713|Ga0066905_100239752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1385 | Open in IMG/M |
3300005713|Ga0066905_100239752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1385 | Open in IMG/M |
3300005713|Ga0066905_100296572 | Not Available | 1267 | Open in IMG/M |
3300005713|Ga0066905_100296572 | Not Available | 1267 | Open in IMG/M |
3300005713|Ga0066905_100320879 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300005713|Ga0066905_100343739 | Not Available | 1189 | Open in IMG/M |
3300005713|Ga0066905_100346602 | Not Available | 1185 | Open in IMG/M |
3300005713|Ga0066905_100366780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
3300005713|Ga0066905_100366780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
3300005713|Ga0066905_100366780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
3300005713|Ga0066905_100412120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1099 | Open in IMG/M |
3300005713|Ga0066905_100451790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
3300005713|Ga0066905_100470030 | Not Available | 1038 | Open in IMG/M |
3300005713|Ga0066905_100501118 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300005713|Ga0066905_100512813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 999 | Open in IMG/M |
3300005713|Ga0066905_100592981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. A_224 | 937 | Open in IMG/M |
3300005713|Ga0066905_100592981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. A_224 | 937 | Open in IMG/M |
3300005713|Ga0066905_100597826 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300005713|Ga0066905_100603553 | Not Available | 929 | Open in IMG/M |
3300005713|Ga0066905_100603553 | Not Available | 929 | Open in IMG/M |
3300005713|Ga0066905_100631988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300005713|Ga0066905_100661705 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300005713|Ga0066905_100775905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
3300005713|Ga0066905_101008963 | Not Available | 734 | Open in IMG/M |
3300005713|Ga0066905_101123396 | Not Available | 699 | Open in IMG/M |
3300005713|Ga0066905_101708576 | Not Available | 578 | Open in IMG/M |
3300005713|Ga0066905_101708576 | Not Available | 578 | Open in IMG/M |
3300005713|Ga0066905_101815499 | Not Available | 563 | Open in IMG/M |
3300005713|Ga0066905_101855868 | Not Available | 557 | Open in IMG/M |
3300005713|Ga0066905_101873927 | Not Available | 554 | Open in IMG/M |
3300005713|Ga0066905_102083339 | Not Available | 527 | Open in IMG/M |
3300005713|Ga0066905_102197100 | Not Available | 515 | Open in IMG/M |
3300005713|Ga0066905_102217041 | Not Available | 512 | Open in IMG/M |
3300005713|Ga0066905_102217041 | Not Available | 512 | Open in IMG/M |
3300005713|Ga0066905_102303825 | Not Available | 503 | Open in IMG/M |
3300005713|Ga0066905_102324948 | Not Available | 501 | Open in IMG/M |
3300005713|Ga0066905_102324948 | Not Available | 501 | Open in IMG/M |
3300005719|Ga0068861_100027039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4175 | Open in IMG/M |
3300005719|Ga0068861_100123459 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300005719|Ga0068861_100212864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1629 | Open in IMG/M |
3300005719|Ga0068861_101416898 | Not Available | 679 | Open in IMG/M |
3300005719|Ga0068861_101416898 | Not Available | 679 | Open in IMG/M |
3300005719|Ga0068861_102126314 | Not Available | 561 | Open in IMG/M |
3300005719|Ga0068861_102126314 | Not Available | 561 | Open in IMG/M |
3300005764|Ga0066903_100053584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 4947 | Open in IMG/M |
3300005764|Ga0066903_100060728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4722 | Open in IMG/M |
3300005764|Ga0066903_100065809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4582 | Open in IMG/M |
3300005764|Ga0066903_100106305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3821 | Open in IMG/M |
3300005764|Ga0066903_100131041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3526 | Open in IMG/M |
3300005764|Ga0066903_100204495 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
3300005764|Ga0066903_100301070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2537 | Open in IMG/M |
3300005764|Ga0066903_100301070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2537 | Open in IMG/M |
3300005764|Ga0066903_100456447 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
3300005764|Ga0066903_100686969 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1800 | Open in IMG/M |
3300005764|Ga0066903_100863703 | Not Available | 1630 | Open in IMG/M |
3300005764|Ga0066903_101106134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1461 | Open in IMG/M |
3300005764|Ga0066903_101157585 | Not Available | 1432 | Open in IMG/M |
3300005764|Ga0066903_101157585 | Not Available | 1432 | Open in IMG/M |
3300005764|Ga0066903_101187330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1415 | Open in IMG/M |
3300005764|Ga0066903_101249463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1383 | Open in IMG/M |
3300005764|Ga0066903_101249463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1383 | Open in IMG/M |
3300005764|Ga0066903_101249463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1383 | Open in IMG/M |
3300005764|Ga0066903_102792179 | Not Available | 947 | Open in IMG/M |
3300005764|Ga0066903_103279919 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300005764|Ga0066903_103539371 | Not Available | 841 | Open in IMG/M |
3300005764|Ga0066903_106565388 | Not Available | 606 | Open in IMG/M |
3300005764|Ga0066903_106690813 | Not Available | 599 | Open in IMG/M |
3300005764|Ga0066903_107539246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 561 | Open in IMG/M |
3300005843|Ga0068860_102781867 | Not Available | 507 | Open in IMG/M |
3300005937|Ga0081455_10000052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 123035 | Open in IMG/M |
3300005937|Ga0081455_10000053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 122071 | Open in IMG/M |
3300005937|Ga0081455_10000087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 99627 | Open in IMG/M |
3300005937|Ga0081455_10000087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 99627 | Open in IMG/M |
3300005937|Ga0081455_10000412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 56264 | Open in IMG/M |
3300005937|Ga0081455_10000994 | All Organisms → cellular organisms → Bacteria | 35958 | Open in IMG/M |
3300005937|Ga0081455_10008681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10527 | Open in IMG/M |
3300005937|Ga0081455_10030979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4848 | Open in IMG/M |
3300005937|Ga0081455_10041954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 4019 | Open in IMG/M |
3300005983|Ga0081540_1000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 109611 | Open in IMG/M |
3300005983|Ga0081540_1000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 109611 | Open in IMG/M |
3300005983|Ga0081540_1000148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 72453 | Open in IMG/M |
3300005983|Ga0081540_1000205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 61689 | Open in IMG/M |
3300005983|Ga0081540_1000515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 37910 | Open in IMG/M |
3300005983|Ga0081540_1000794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28989 | Open in IMG/M |
3300005983|Ga0081540_1001096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 23968 | Open in IMG/M |
3300005983|Ga0081540_1053695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1974 | Open in IMG/M |
3300005983|Ga0081540_1070488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1618 | Open in IMG/M |
3300005983|Ga0081540_1070488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1618 | Open in IMG/M |
3300005983|Ga0081540_1165945 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300006049|Ga0075417_10235465 | Not Available | 875 | Open in IMG/M |
3300006163|Ga0070715_10010800 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
3300006163|Ga0070715_10184996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1047 | Open in IMG/M |
3300006163|Ga0070715_10184996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1047 | Open in IMG/M |
3300006173|Ga0070716_100505718 | Not Available | 892 | Open in IMG/M |
3300006175|Ga0070712_100853606 | Not Available | 783 | Open in IMG/M |
3300006196|Ga0075422_10028674 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300006196|Ga0075422_10032913 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300006196|Ga0075422_10044349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
3300006196|Ga0075422_10116624 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300006196|Ga0075422_10444806 | Not Available | 580 | Open in IMG/M |
3300006196|Ga0075422_10491540 | Not Available | 555 | Open in IMG/M |
3300006755|Ga0079222_10052102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1908 | Open in IMG/M |
3300006755|Ga0079222_10441289 | Not Available | 926 | Open in IMG/M |
3300006755|Ga0079222_10776033 | Not Available | 777 | Open in IMG/M |
3300006755|Ga0079222_10832079 | Not Available | 760 | Open in IMG/M |
3300006755|Ga0079222_10872021 | Not Available | 749 | Open in IMG/M |
3300006755|Ga0079222_11140728 | Not Available | 690 | Open in IMG/M |
3300006844|Ga0075428_100012055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9617 | Open in IMG/M |
3300006844|Ga0075428_100041676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5047 | Open in IMG/M |
3300006844|Ga0075428_100204444 | Not Available | 2134 | Open in IMG/M |
3300006844|Ga0075428_100263969 | Not Available | 1854 | Open in IMG/M |
3300006844|Ga0075428_100537027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1250 | Open in IMG/M |
3300006844|Ga0075428_100684579 | Not Available | 1093 | Open in IMG/M |
3300006844|Ga0075428_102010739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 599 | Open in IMG/M |
3300006844|Ga0075428_102083683 | Not Available | 587 | Open in IMG/M |
3300006847|Ga0075431_100160045 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
3300006852|Ga0075433_10001436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17569 | Open in IMG/M |
3300006852|Ga0075433_10003351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12384 | Open in IMG/M |
3300006852|Ga0075433_10005438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10007 | Open in IMG/M |
3300006852|Ga0075433_10013326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6680 | Open in IMG/M |
3300006852|Ga0075433_10251082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1569 | Open in IMG/M |
3300006852|Ga0075433_10322482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1367 | Open in IMG/M |
3300006852|Ga0075433_10358213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
3300006852|Ga0075433_11829876 | Not Available | 522 | Open in IMG/M |
3300006854|Ga0075425_100004320 | All Organisms → cellular organisms → Bacteria | 14642 | Open in IMG/M |
3300006854|Ga0075425_100116758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3044 | Open in IMG/M |
3300006854|Ga0075425_100811137 | Not Available | 1072 | Open in IMG/M |
3300006871|Ga0075434_100012676 | All Organisms → cellular organisms → Bacteria | 7995 | Open in IMG/M |
3300006871|Ga0075434_102173728 | Not Available | 559 | Open in IMG/M |
3300006871|Ga0075434_102576843 | Not Available | 509 | Open in IMG/M |
3300006880|Ga0075429_101645771 | Not Available | 558 | Open in IMG/M |
3300006903|Ga0075426_10215498 | Not Available | 1393 | Open in IMG/M |
3300006904|Ga0075424_100001322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 21594 | Open in IMG/M |
3300006904|Ga0075424_100098196 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
3300006904|Ga0075424_100929951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 927 | Open in IMG/M |
3300006904|Ga0075424_102052612 | Not Available | 603 | Open in IMG/M |
3300006904|Ga0075424_102573539 | Not Available | 532 | Open in IMG/M |
3300006937|Ga0081243_1008363 | Not Available | 528 | Open in IMG/M |
3300006954|Ga0079219_10111011 | Not Available | 1372 | Open in IMG/M |
3300006954|Ga0079219_10618689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81 | 798 | Open in IMG/M |
3300006954|Ga0079219_11409481 | Not Available | 623 | Open in IMG/M |
3300009081|Ga0105098_10288198 | Not Available | 785 | Open in IMG/M |
3300009094|Ga0111539_10010044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11930 | Open in IMG/M |
3300009094|Ga0111539_10014925 | All Organisms → cellular organisms → Bacteria | 9681 | Open in IMG/M |
3300009094|Ga0111539_10162935 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
3300009094|Ga0111539_10167767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 38 | 2565 | Open in IMG/M |
3300009094|Ga0111539_10186565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2422 | Open in IMG/M |
3300009094|Ga0111539_10193572 | Not Available | 2372 | Open in IMG/M |
3300009094|Ga0111539_10257410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2032 | Open in IMG/M |
3300009094|Ga0111539_10303627 | Not Available | 1857 | Open in IMG/M |
3300009094|Ga0111539_10420089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1557 | Open in IMG/M |
3300009094|Ga0111539_10495678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1423 | Open in IMG/M |
3300009094|Ga0111539_10640434 | Not Available | 1238 | Open in IMG/M |
3300009094|Ga0111539_10692131 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300009094|Ga0111539_11639659 | Not Available | 746 | Open in IMG/M |
3300009094|Ga0111539_12318382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 623 | Open in IMG/M |
3300009094|Ga0111539_12385205 | Not Available | 614 | Open in IMG/M |
3300009098|Ga0105245_11975691 | Not Available | 637 | Open in IMG/M |
3300009100|Ga0075418_10033939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5545 | Open in IMG/M |
3300009100|Ga0075418_10055276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 4248 | Open in IMG/M |
3300009100|Ga0075418_10451544 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300009100|Ga0075418_10569956 | Not Available | 1218 | Open in IMG/M |
3300009100|Ga0075418_10569956 | Not Available | 1218 | Open in IMG/M |
3300009100|Ga0075418_11086436 | Not Available | 866 | Open in IMG/M |
3300009100|Ga0075418_12241090 | Not Available | 596 | Open in IMG/M |
3300009100|Ga0075418_12662887 | Not Available | 546 | Open in IMG/M |
3300009146|Ga0105091_10124937 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300009146|Ga0105091_10470751 | Not Available | 634 | Open in IMG/M |
3300009147|Ga0114129_10068788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4936 | Open in IMG/M |
3300009147|Ga0114129_10179324 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
3300009147|Ga0114129_10194890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2748 | Open in IMG/M |
3300009147|Ga0114129_10332303 | Not Available | 2017 | Open in IMG/M |
3300009147|Ga0114129_12409927 | Not Available | 630 | Open in IMG/M |
3300009156|Ga0111538_10070340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4456 | Open in IMG/M |
3300009156|Ga0111538_10155527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2904 | Open in IMG/M |
3300009156|Ga0111538_10238009 | Not Available | 2306 | Open in IMG/M |
3300009156|Ga0111538_10249878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2245 | Open in IMG/M |
3300009156|Ga0111538_10279394 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300009156|Ga0111538_10280837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2108 | Open in IMG/M |
3300009156|Ga0111538_10414814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1705 | Open in IMG/M |
3300009156|Ga0111538_10716092 | Not Available | 1268 | Open in IMG/M |
3300009156|Ga0111538_11358189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 897 | Open in IMG/M |
3300009156|Ga0111538_11530740 | Not Available | 841 | Open in IMG/M |
3300009156|Ga0111538_11782725 | Not Available | 775 | Open in IMG/M |
3300009156|Ga0111538_12214767 | Not Available | 690 | Open in IMG/M |
3300009156|Ga0111538_12214767 | Not Available | 690 | Open in IMG/M |
3300009162|Ga0075423_10010923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8738 | Open in IMG/M |
3300009174|Ga0105241_10946031 | Not Available | 803 | Open in IMG/M |
3300009174|Ga0105241_11631144 | Not Available | 625 | Open in IMG/M |
3300009174|Ga0105241_12654429 | Not Available | 504 | Open in IMG/M |
3300009792|Ga0126374_10018708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2983 | Open in IMG/M |
3300009792|Ga0126374_10121900 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300009792|Ga0126374_10233731 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300009792|Ga0126374_10286987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1095 | Open in IMG/M |
3300009792|Ga0126374_10286987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1095 | Open in IMG/M |
3300009792|Ga0126374_10359510 | Not Available | 1002 | Open in IMG/M |
3300009792|Ga0126374_10883082 | Not Available | 691 | Open in IMG/M |
3300009792|Ga0126374_11640222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 533 | Open in IMG/M |
3300010043|Ga0126380_10020413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3171 | Open in IMG/M |
3300010043|Ga0126380_10022341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3062 | Open in IMG/M |
3300010043|Ga0126380_10063224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
3300010043|Ga0126380_10173451 | Not Available | 1411 | Open in IMG/M |
3300010043|Ga0126380_10289249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1159 | Open in IMG/M |
3300010043|Ga0126380_10478864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
3300010046|Ga0126384_10000111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 35873 | Open in IMG/M |
3300010046|Ga0126384_10000556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20739 | Open in IMG/M |
3300010046|Ga0126384_10032455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3478 | Open in IMG/M |
3300010046|Ga0126384_10173836 | Not Available | 1680 | Open in IMG/M |
3300010046|Ga0126384_12159409 | Not Available | 535 | Open in IMG/M |
3300010046|Ga0126384_12159409 | Not Available | 535 | Open in IMG/M |
3300010047|Ga0126382_10010303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4456 | Open in IMG/M |
3300010047|Ga0126382_10010303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4456 | Open in IMG/M |
3300010047|Ga0126382_10010359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 4446 | Open in IMG/M |
3300010047|Ga0126382_10011613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4255 | Open in IMG/M |
3300010047|Ga0126382_10020113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3456 | Open in IMG/M |
3300010047|Ga0126382_10037828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2717 | Open in IMG/M |
3300010047|Ga0126382_10050853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2426 | Open in IMG/M |
3300010047|Ga0126382_10051684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2411 | Open in IMG/M |
3300010047|Ga0126382_10057761 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300010047|Ga0126382_10166267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1530 | Open in IMG/M |
3300010047|Ga0126382_10220047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1367 | Open in IMG/M |
3300010047|Ga0126382_10250067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1298 | Open in IMG/M |
3300010047|Ga0126382_10389700 | Not Available | 1083 | Open in IMG/M |
3300010047|Ga0126382_10548330 | Not Available | 940 | Open in IMG/M |
3300010047|Ga0126382_10548330 | Not Available | 940 | Open in IMG/M |
3300010047|Ga0126382_10614637 | Not Available | 897 | Open in IMG/M |
3300010047|Ga0126382_10661689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 870 | Open in IMG/M |
3300010047|Ga0126382_10664920 | Not Available | 868 | Open in IMG/M |
3300010047|Ga0126382_10745276 | Not Available | 828 | Open in IMG/M |
3300010047|Ga0126382_11240958 | Not Available | 670 | Open in IMG/M |
3300010047|Ga0126382_11546513 | Not Available | 612 | Open in IMG/M |
3300010047|Ga0126382_12036169 | Not Available | 547 | Open in IMG/M |
3300010047|Ga0126382_12055466 | Not Available | 545 | Open in IMG/M |
3300010047|Ga0126382_12198198 | Not Available | 531 | Open in IMG/M |
3300010358|Ga0126370_11324388 | Not Available | 676 | Open in IMG/M |
3300010358|Ga0126370_11324388 | Not Available | 676 | Open in IMG/M |
3300010358|Ga0126370_12131874 | Not Available | 551 | Open in IMG/M |
3300010359|Ga0126376_10007603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6609 | Open in IMG/M |
3300010360|Ga0126372_10186975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1707 | Open in IMG/M |
3300010360|Ga0126372_10316768 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300010360|Ga0126372_10467203 | Not Available | 1175 | Open in IMG/M |
3300010360|Ga0126372_10849458 | Not Available | 910 | Open in IMG/M |
3300010360|Ga0126372_12234301 | Not Available | 596 | Open in IMG/M |
3300010360|Ga0126372_12433996 | Not Available | 574 | Open in IMG/M |
3300010362|Ga0126377_10002252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13186 | Open in IMG/M |
3300010362|Ga0126377_10007651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8228 | Open in IMG/M |
3300010362|Ga0126377_10007651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8228 | Open in IMG/M |
3300010362|Ga0126377_10009901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7380 | Open in IMG/M |
3300010362|Ga0126377_10020059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5480 | Open in IMG/M |
3300010362|Ga0126377_10030460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4555 | Open in IMG/M |
3300010362|Ga0126377_10089699 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
3300010362|Ga0126377_10110064 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
3300010362|Ga0126377_10267542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1672 | Open in IMG/M |
3300010362|Ga0126377_10350842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1472 | Open in IMG/M |
3300010362|Ga0126377_10366068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1443 | Open in IMG/M |
3300010362|Ga0126377_10541466 | Not Available | 1202 | Open in IMG/M |
3300010362|Ga0126377_10646597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1106 | Open in IMG/M |
3300010362|Ga0126377_10656382 | Not Available | 1098 | Open in IMG/M |
3300010362|Ga0126377_10698962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1067 | Open in IMG/M |
3300010362|Ga0126377_10994535 | Not Available | 905 | Open in IMG/M |
3300010362|Ga0126377_10994535 | Not Available | 905 | Open in IMG/M |
3300010362|Ga0126377_11092182 | Not Available | 866 | Open in IMG/M |
3300010362|Ga0126377_11192045 | Not Available | 832 | Open in IMG/M |
3300010362|Ga0126377_11958511 | Not Available | 662 | Open in IMG/M |
3300010362|Ga0126377_11997751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 656 | Open in IMG/M |
3300010362|Ga0126377_12008711 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300010362|Ga0126377_12759083 | Not Available | 566 | Open in IMG/M |
3300010362|Ga0126377_12966890 | Not Available | 547 | Open in IMG/M |
3300010362|Ga0126377_13104414 | Not Available | 536 | Open in IMG/M |
3300010362|Ga0126377_13275924 | Not Available | 523 | Open in IMG/M |
3300010362|Ga0126377_13452873 | Not Available | 511 | Open in IMG/M |
3300010366|Ga0126379_11442188 | Not Available | 794 | Open in IMG/M |
3300010366|Ga0126379_11442188 | Not Available | 794 | Open in IMG/M |
3300010366|Ga0126379_11442188 | Not Available | 794 | Open in IMG/M |
3300010371|Ga0134125_10836405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
3300010371|Ga0134125_12662582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 544 | Open in IMG/M |
3300010396|Ga0134126_10892780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1000 | Open in IMG/M |
3300010396|Ga0134126_11221557 | Not Available | 835 | Open in IMG/M |
3300010399|Ga0134127_13460916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 517 | Open in IMG/M |
3300010400|Ga0134122_10003024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12410 | Open in IMG/M |
3300010400|Ga0134122_10003024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12410 | Open in IMG/M |
3300010400|Ga0134122_11163555 | Not Available | 769 | Open in IMG/M |
3300010400|Ga0134122_13356903 | Not Available | 504 | Open in IMG/M |
3300010403|Ga0134123_13302725 | Not Available | 520 | Open in IMG/M |
3300010403|Ga0134123_13383546 | Not Available | 515 | Open in IMG/M |
3300012483|Ga0157337_1005959 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300012486|Ga0157331_1038021 | Not Available | 509 | Open in IMG/M |
3300012492|Ga0157335_1023070 | Not Available | 605 | Open in IMG/M |
3300012493|Ga0157355_1042555 | Not Available | 514 | Open in IMG/M |
3300012503|Ga0157313_1060880 | Not Available | 516 | Open in IMG/M |
3300012513|Ga0157326_1067064 | Not Available | 561 | Open in IMG/M |
3300012948|Ga0126375_10005019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5007 | Open in IMG/M |
3300012948|Ga0126375_10005019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5007 | Open in IMG/M |
3300012948|Ga0126375_10072015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1942 | Open in IMG/M |
3300012948|Ga0126375_10105142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1682 | Open in IMG/M |
3300012948|Ga0126375_10139813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1509 | Open in IMG/M |
3300012948|Ga0126375_10179584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1368 | Open in IMG/M |
3300012948|Ga0126375_10216250 | Not Available | 1271 | Open in IMG/M |
3300012948|Ga0126375_10216250 | Not Available | 1271 | Open in IMG/M |
3300012948|Ga0126375_10405512 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300012948|Ga0126375_10478583 | Not Available | 922 | Open in IMG/M |
3300012948|Ga0126375_10852667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300012948|Ga0126375_11020426 | Not Available | 675 | Open in IMG/M |
3300012948|Ga0126375_11231397 | Not Available | 625 | Open in IMG/M |
3300012948|Ga0126375_11387083 | Not Available | 595 | Open in IMG/M |
3300012948|Ga0126375_11983518 | Not Available | 514 | Open in IMG/M |
3300012957|Ga0164303_10982050 | Not Available | 599 | Open in IMG/M |
3300012960|Ga0164301_10826740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 711 | Open in IMG/M |
3300012971|Ga0126369_10893143 | Not Available | 974 | Open in IMG/M |
3300012986|Ga0164304_10323855 | Not Available | 1066 | Open in IMG/M |
3300015371|Ga0132258_10001529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 40869 | Open in IMG/M |
3300015371|Ga0132258_10003035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 31627 | Open in IMG/M |
3300015371|Ga0132258_10003618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 29552 | Open in IMG/M |
3300015371|Ga0132258_10003618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 29552 | Open in IMG/M |
3300015371|Ga0132258_10005976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 24058 | Open in IMG/M |
3300015371|Ga0132258_10010513 | All Organisms → cellular organisms → Bacteria | 19218 | Open in IMG/M |
3300015371|Ga0132258_10013649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 17226 | Open in IMG/M |
3300015371|Ga0132258_10024931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13184 | Open in IMG/M |
3300015371|Ga0132258_10078625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 7684 | Open in IMG/M |
3300015371|Ga0132258_10136080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5868 | Open in IMG/M |
3300015371|Ga0132258_10324219 | Not Available | 3799 | Open in IMG/M |
3300015371|Ga0132258_10337780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3720 | Open in IMG/M |
3300015371|Ga0132258_11357151 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
3300015371|Ga0132258_11357151 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
3300015371|Ga0132258_11376453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1783 | Open in IMG/M |
3300015371|Ga0132258_11657097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
3300015371|Ga0132258_12215871 | Not Available | 1379 | Open in IMG/M |
3300015371|Ga0132258_12300138 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300015371|Ga0132258_12300138 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300015371|Ga0132258_12581425 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300015372|Ga0132256_101180305 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300015372|Ga0132256_102123338 | Not Available | 667 | Open in IMG/M |
3300015372|Ga0132256_102418055 | Not Available | 628 | Open in IMG/M |
3300015373|Ga0132257_100836547 | Not Available | 1151 | Open in IMG/M |
3300015373|Ga0132257_101063102 | Not Available | 1020 | Open in IMG/M |
3300015373|Ga0132257_101588306 | Not Available | 836 | Open in IMG/M |
3300015374|Ga0132255_100081555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4334 | Open in IMG/M |
3300015374|Ga0132255_100452995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1878 | Open in IMG/M |
3300015374|Ga0132255_100722043 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300015374|Ga0132255_101876368 | Not Available | 911 | Open in IMG/M |
3300015374|Ga0132255_105848193 | Not Available | 520 | Open in IMG/M |
3300017792|Ga0163161_10461304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1028 | Open in IMG/M |
3300017970|Ga0187783_10351324 | Not Available | 1073 | Open in IMG/M |
3300017970|Ga0187783_10439469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1 | 947 | Open in IMG/M |
3300018078|Ga0184612_10146787 | Not Available | 1233 | Open in IMG/M |
3300018081|Ga0184625_10226898 | Not Available | 979 | Open in IMG/M |
3300018429|Ga0190272_12083211 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300018429|Ga0190272_12083211 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300018469|Ga0190270_11560614 | Not Available | 711 | Open in IMG/M |
3300018476|Ga0190274_12943817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 571 | Open in IMG/M |
3300019212|Ga0180106_1159132 | Not Available | 635 | Open in IMG/M |
3300019233|Ga0184645_1133644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 640 | Open in IMG/M |
3300019233|Ga0184645_1232531 | Not Available | 544 | Open in IMG/M |
3300019233|Ga0184645_1232531 | Not Available | 544 | Open in IMG/M |
3300019377|Ga0190264_10705387 | Not Available | 746 | Open in IMG/M |
3300022531|Ga0242660_1248166 | Not Available | 507 | Open in IMG/M |
3300022533|Ga0242662_10167837 | Not Available | 674 | Open in IMG/M |
3300025911|Ga0207654_10502777 | Not Available | 856 | Open in IMG/M |
3300025916|Ga0207663_10242305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1323 | Open in IMG/M |
3300025932|Ga0207690_11273071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300025933|Ga0207706_10893453 | Not Available | 751 | Open in IMG/M |
3300025935|Ga0207709_11282493 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025939|Ga0207665_10553397 | Not Available | 894 | Open in IMG/M |
3300025972|Ga0207668_10629713 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300025972|Ga0207668_10629713 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300025972|Ga0207668_11158027 | Not Available | 694 | Open in IMG/M |
3300025972|Ga0207668_11158027 | Not Available | 694 | Open in IMG/M |
3300025972|Ga0207668_12075301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329 | 512 | Open in IMG/M |
3300026067|Ga0207678_10143252 | Not Available | 2040 | Open in IMG/M |
3300026067|Ga0207678_10272963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1450 | Open in IMG/M |
3300026067|Ga0207678_10344366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1285 | Open in IMG/M |
3300026067|Ga0207678_10345284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1283 | Open in IMG/M |
3300026067|Ga0207678_11198076 | Not Available | 672 | Open in IMG/M |
3300026067|Ga0207678_11797248 | Not Available | 537 | Open in IMG/M |
3300026075|Ga0207708_10011940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 6470 | Open in IMG/M |
3300026075|Ga0207708_10027541 | All Organisms → cellular organisms → Bacteria | 4303 | Open in IMG/M |
3300026075|Ga0207708_10237481 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300026118|Ga0207675_100569646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1133 | Open in IMG/M |
3300027646|Ga0209466_1096641 | Not Available | 598 | Open in IMG/M |
3300027646|Ga0209466_1096641 | Not Available | 598 | Open in IMG/M |
3300027646|Ga0209466_1108385 | Not Available | 564 | Open in IMG/M |
3300027775|Ga0209177_10022328 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300027775|Ga0209177_10022328 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300027775|Ga0209177_10036270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81 | 1325 | Open in IMG/M |
3300027787|Ga0209074_10142989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
3300027787|Ga0209074_10299477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
3300027787|Ga0209074_10305578 | Not Available | 637 | Open in IMG/M |
3300027787|Ga0209074_10426201 | Not Available | 561 | Open in IMG/M |
3300027873|Ga0209814_10136625 | Not Available | 1049 | Open in IMG/M |
3300027873|Ga0209814_10348922 | Not Available | 647 | Open in IMG/M |
3300027907|Ga0207428_10014697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6786 | Open in IMG/M |
3300027907|Ga0207428_10015084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6691 | Open in IMG/M |
3300027907|Ga0207428_10021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5387 | Open in IMG/M |
3300027907|Ga0207428_10021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5387 | Open in IMG/M |
3300027907|Ga0207428_10021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5387 | Open in IMG/M |
3300027907|Ga0207428_10025405 | All Organisms → cellular organisms → Bacteria | 4959 | Open in IMG/M |
3300027907|Ga0207428_10141871 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300027907|Ga0207428_10143549 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300027907|Ga0207428_10176119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1618 | Open in IMG/M |
3300027907|Ga0207428_10192160 | Not Available | 1538 | Open in IMG/M |
3300027907|Ga0207428_10310462 | Not Available | 1166 | Open in IMG/M |
3300027907|Ga0207428_10414226 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300027907|Ga0207428_10431992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300027907|Ga0207428_10457138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 930 | Open in IMG/M |
3300027907|Ga0207428_10569311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
3300027907|Ga0207428_10611891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 784 | Open in IMG/M |
3300027907|Ga0207428_10705517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
3300027907|Ga0207428_10793139 | Not Available | 673 | Open in IMG/M |
3300027907|Ga0207428_11233343 | Not Available | 520 | Open in IMG/M |
3300027909|Ga0209382_10224147 | Not Available | 2144 | Open in IMG/M |
3300027911|Ga0209698_11081826 | Not Available | 595 | Open in IMG/M |
3300028381|Ga0268264_12421482 | Not Available | 531 | Open in IMG/M |
3300028381|Ga0268264_12618356 | Not Available | 509 | Open in IMG/M |
3300028381|Ga0268264_12618356 | Not Available | 509 | Open in IMG/M |
3300031184|Ga0307499_10031838 | Not Available | 1203 | Open in IMG/M |
3300031184|Ga0307499_10066259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 922 | Open in IMG/M |
3300031184|Ga0307499_10066259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 922 | Open in IMG/M |
3300031184|Ga0307499_10078460 | Not Available | 866 | Open in IMG/M |
3300031184|Ga0307499_10195213 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031198|Ga0307500_10207995 | Not Available | 587 | Open in IMG/M |
3300031198|Ga0307500_10250979 | Not Available | 546 | Open in IMG/M |
3300031198|Ga0307500_10277776 | Not Available | 525 | Open in IMG/M |
3300031562|Ga0310886_10233814 | Not Available | 1020 | Open in IMG/M |
3300031576|Ga0247727_10000777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 77942 | Open in IMG/M |
3300031576|Ga0247727_10000777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 77942 | Open in IMG/M |
3300031576|Ga0247727_10000777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 77942 | Open in IMG/M |
3300031677|Ga0307480_1008049 | Not Available | 698 | Open in IMG/M |
3300031677|Ga0307480_1008049 | Not Available | 698 | Open in IMG/M |
3300031677|Ga0307480_1008959 | Not Available | 675 | Open in IMG/M |
3300031677|Ga0307480_1008959 | Not Available | 675 | Open in IMG/M |
3300031677|Ga0307480_1008959 | Not Available | 675 | Open in IMG/M |
3300031677|Ga0307480_1024266 | Not Available | 504 | Open in IMG/M |
3300031677|Ga0307480_1024266 | Not Available | 504 | Open in IMG/M |
3300031720|Ga0307469_10068843 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
3300031720|Ga0307469_10391477 | Not Available | 1183 | Open in IMG/M |
3300031720|Ga0307469_10594822 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300031720|Ga0307469_10660857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
3300031720|Ga0307469_10797750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 866 | Open in IMG/M |
3300031720|Ga0307469_11335422 | Not Available | 682 | Open in IMG/M |
3300031720|Ga0307469_11957154 | Not Available | 568 | Open in IMG/M |
3300031740|Ga0307468_100009859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3670 | Open in IMG/M |
3300031740|Ga0307468_100042499 | Not Available | 2295 | Open in IMG/M |
3300031740|Ga0307468_100046460 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
3300031740|Ga0307468_100254956 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300031740|Ga0307468_100254956 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300031740|Ga0307468_100262292 | Not Available | 1224 | Open in IMG/M |
3300031820|Ga0307473_10588168 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300031908|Ga0310900_10226762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1331 | Open in IMG/M |
3300031908|Ga0310900_10466380 | Not Available | 974 | Open in IMG/M |
3300031908|Ga0310900_10512489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 934 | Open in IMG/M |
3300031908|Ga0310900_11212679 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300031908|Ga0310900_11534090 | Not Available | 562 | Open in IMG/M |
3300031949|Ga0214473_12210029 | Not Available | 530 | Open in IMG/M |
3300032012|Ga0310902_10834678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
3300032174|Ga0307470_10033314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2477 | Open in IMG/M |
3300032174|Ga0307470_10158716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1394 | Open in IMG/M |
3300032174|Ga0307470_10204140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1266 | Open in IMG/M |
3300032174|Ga0307470_10725906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 760 | Open in IMG/M |
3300032174|Ga0307470_10907935 | Not Available | 692 | Open in IMG/M |
3300032174|Ga0307470_10926227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 687 | Open in IMG/M |
3300032179|Ga0310889_10657958 | Not Available | 544 | Open in IMG/M |
3300032180|Ga0307471_100139554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2306 | Open in IMG/M |
3300032180|Ga0307471_100435672 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300032180|Ga0307471_100435672 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300032180|Ga0307471_100912321 | Not Available | 1046 | Open in IMG/M |
3300032205|Ga0307472_100454908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1089 | Open in IMG/M |
3300032205|Ga0307472_100913175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
3300032205|Ga0307472_101542524 | Not Available | 650 | Open in IMG/M |
3300034660|Ga0314781_078459 | Not Available | 635 | Open in IMG/M |
3300034661|Ga0314782_161934 | Not Available | 556 | Open in IMG/M |
3300034661|Ga0314782_161934 | Not Available | 556 | Open in IMG/M |
3300034669|Ga0314794_082409 | Not Available | 663 | Open in IMG/M |
3300034670|Ga0314795_063650 | Not Available | 678 | Open in IMG/M |
3300034670|Ga0314795_126782 | Not Available | 535 | Open in IMG/M |
3300034670|Ga0314795_126782 | Not Available | 535 | Open in IMG/M |
3300034671|Ga0314796_172417 | Not Available | 519 | Open in IMG/M |
3300034672|Ga0314797_132480 | Not Available | 539 | Open in IMG/M |
3300034817|Ga0373948_0031554 | Not Available | 1071 | Open in IMG/M |
3300034817|Ga0373948_0151482 | Not Available | 580 | Open in IMG/M |
3300034818|Ga0373950_0025762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1064 | Open in IMG/M |
3300034818|Ga0373950_0117692 | Not Available | 585 | Open in IMG/M |
3300034819|Ga0373958_0150531 | Not Available | 582 | Open in IMG/M |
3300034819|Ga0373958_0197503 | Not Available | 525 | Open in IMG/M |
3300034820|Ga0373959_0142653 | Not Available | 601 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.51% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.15% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.92% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.51% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.11% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.58% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.23% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.35% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.18% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.18% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.70% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.70% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003725 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_132624002 | 3300000363 | Soil | MQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN* |
INPhiseqgaiiFebDRAFT_1003435751 | 3300000364 | Soil | MKTILSALVALSVIASVAVPANALDAKTFFEQVDRDHN* |
F24TB_100703053 | 3300000550 | Soil | MKTITSALVALLMIAGVTGTANAFDARTFYEQIDRDHN* |
F24TB_118179001 | 3300000550 | Soil | MQTITSALVALLLLTGIASSAQALDARSFYEQVDRNHN* |
JGI11643J11755_106935382 | 3300000787 | Soil | MQTITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN* |
JGI10213J12805_100066122 | 3300000858 | Soil | MKTVLSALVAFSLIAGIAGTASALDAKAFYEQVDRTHN* |
JGI10213J12805_100066123 | 3300000858 | Soil | MKTILSALIALSVIAGIAQTASAFDAKTFYEQVDRDHN* |
JGI10213J12805_102226832 | 3300000858 | Soil | MQTILSALVALLVIASVAGVAHALDAKSFYEEIDRTHY* |
JGI10213J12805_107829743 | 3300000858 | Soil | MKTILSALVALSVIAGVAGTASAFDAKDFYEQVDRNHN* |
JGI10213J12805_107829744 | 3300000858 | Soil | MKTILSALVALSVIVGVASGAVAIDTKEFYERVDRNHF* |
JGI10213J12805_115584941 | 3300000858 | Soil | LGILRGEIAMKTILSALIALSVIAGVASTASAMDTREFYERVDRNHF* |
F14TB_1011528061 | 3300001431 | Soil | SALFALSVLAGFAGTAAANVDAKTFYEQVDRDRF* |
F14TB_1014664942 | 3300001431 | Soil | MKTITSALVALLMIAGVTGTANAFDARTFXXXXDRDHN* |
F14TB_1017582722 | 3300001431 | Soil | MKTILSALVALSVIASVAGTASALDAKTFFEQVDRDHN* |
JGI25404J52841_101019051 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MIMKTILSALVALSVIAGVAGSASAFDAKSFYEQIDRNHN* |
Ga0008087_1083602 | 3300003725 | Tropical Rainforest Soil | LIMKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRNHN* |
Ga0008087_1083603 | 3300003725 | Tropical Rainforest Soil | LIMKTILSALVALSVIAGVAGTASALDAKTFYEQVDRDHN* |
Ga0066398_101963911 | 3300004268 | Tropical Forest Soil | TVNQPLKRRMIMKLIMSALVALSVITGVAGSANAFDTKTFFEQVDRDHN* |
Ga0066397_100082232 | 3300004281 | Tropical Forest Soil | MIMKLIMSALVALSVIAGVAGSANAFDTKTFFEQVDRDHN* |
Ga0066397_100742631 | 3300004281 | Tropical Forest Soil | MKTILSAIVALSVIAGVAGSASAALDAKTFFEQVDRDHN* |
Ga0066397_100742632 | 3300004281 | Tropical Forest Soil | MIMKTILSALIALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0062595_1000339863 | 3300004479 | Soil | MQTITSAAVIALMLLTGIAGAAQALDAKSFYEQVDRNHN* |
Ga0062595_1000451644 | 3300004479 | Soil | MIMKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN* |
Ga0062594_1005916113 | 3300005093 | Soil | MIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN* |
Ga0066388_1000370176 | 3300005332 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGTASALDAKTFWEQIDRDHN* |
Ga0066388_1000577161 | 3300005332 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0066388_1004624564 | 3300005332 | Tropical Forest Soil | LNRRRETMKSILSALVALSVIAGVAGSASAFDAKTFYEQIDRNGN* |
Ga0066388_1007377082 | 3300005332 | Tropical Forest Soil | MKTITSAVVGALVALLAIAGVAGMAQAFDTKAFYEQVDRNHN* |
Ga0066388_1010177112 | 3300005332 | Tropical Forest Soil | NRGKISMKTILSALVALSVIAGIAGTASAFDTKTFYEQIDRDHN* |
Ga0066388_1025666722 | 3300005332 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0066388_1036977232 | 3300005332 | Tropical Forest Soil | LGALRGEIAMKIILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0066388_1038676292 | 3300005332 | Tropical Forest Soil | MIMKIILSALIALSVIAGGAASASALDAKTFFEQVDRDHN* |
Ga0066388_1058185842 | 3300005332 | Tropical Forest Soil | MSTILSALVALSVIAGVAGTANAFDAKSFYEQVDRNHN*PVTMPRP |
Ga0066388_1067643922 | 3300005332 | Tropical Forest Soil | MIMKLIMSALVVLSVIAGVAGSANAFDTKTFFEQVDRDHN* |
Ga0068869_1012236322 | 3300005334 | Miscanthus Rhizosphere | QLSKRRMIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0070663_1003023833 | 3300005455 | Corn Rhizosphere | MKTILSALIALSVLAGFAGNAAANVDAKSFYEQVDRDRF* |
Ga0070697_1005259621 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QTVNRPHQRRMIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN* |
Ga0070695_1000113115 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN* |
Ga0070704_1007414401 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EELAMKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN* |
Ga0066905_1000008365 | 3300005713 | Tropical Forest Soil | MKTITSALVALLLIAGVAGTAQAYDAKAFFEQVDRNHN* |
Ga0066905_1000034353 | 3300005713 | Tropical Forest Soil | MQTITSALVALLVIAGVAGAAQAFDAKTFYEQIDRNHN* |
Ga0066905_1000077403 | 3300005713 | Tropical Forest Soil | MKTITSALVALVLLTGITGSAHALDAKRFYEQVDRKHN* |
Ga0066905_1000105996 | 3300005713 | Tropical Forest Soil | MKTILSVLIALSVIASVAGTASAMDAKEFYERVDRSHF* |
Ga0066905_1000105997 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKAFFEQIDRDHN* |
Ga0066905_1000111524 | 3300005713 | Tropical Forest Soil | MKTIVSALIALSVLAGFAGTAAANVDAKTFYEQVDRDRF* |
Ga0066905_1000220496 | 3300005713 | Tropical Forest Soil | MKLIMSALVALSVIAGVAGSANAFDTKTFFEQVDRDHN* |
Ga0066905_1000220497 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAMDAKEFYEQVDRNHF* |
Ga0066905_1000329082 | 3300005713 | Tropical Forest Soil | MKTITSAVVALLVIAGVAGAAQAFDAKSFYEQVDRNHN* |
Ga0066905_1000353612 | 3300005713 | Tropical Forest Soil | MKTILSALIALAVIAGVAGTASALDTKAFFEQIDRDHN* |
Ga0066905_1000482141 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASALDAKTFWEQVDRNHN* |
Ga0066905_1000482142 | 3300005713 | Tropical Forest Soil | MKTILSVLVALSVIAGVAGAASAMDTKEFYERVDRNHF* |
Ga0066905_1000656154 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGFAGTTSAFDTKIFYEQIDRDHN* |
Ga0066905_1000663015 | 3300005713 | Tropical Forest Soil | GEIAMKTILSALVALSVIASSASALDAKTFFEQVDRDHN* |
Ga0066905_1000723631 | 3300005713 | Tropical Forest Soil | MKTILSALLALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0066905_1000848474 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIASAAGPANALDAKTFFEQVDRDHN* |
Ga0066905_1000984883 | 3300005713 | Tropical Forest Soil | MKTITSALIALLVIAGAAGTANAFDATIFYEQVDRNRN* |
Ga0066905_1000992822 | 3300005713 | Tropical Forest Soil | MQTITSALVALMLITGIAGAAQALDAKSFYERVDRNHN* |
Ga0066905_1001006212 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVLAGFAGTAAANVDTKAFYEQVDRDRF* |
Ga0066905_1001043743 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSARALDAKTFFEQVDRDHN* |
Ga0066905_1001123822 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKSFYEQVDRNHY* |
Ga0066905_1001216171 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAFDAKDFYEQLDRNHN* |
Ga0066905_1001338292 | 3300005713 | Tropical Forest Soil | MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0066905_1001338983 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVVTGVAGTANALDAKTFWEQIDRDHN* |
Ga0066905_1001338984 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0066905_1001353612 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVIAGVAGTASAMDTKEFYERVDRNHF* |
Ga0066905_1001411232 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVIVGVAGSASAFDAKEFYERVDRNHN* |
Ga0066905_1001688932 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAFDTKTFFEQVDRDHN* |
Ga0066905_1001740232 | 3300005713 | Tropical Forest Soil | MKTILSALVALSLIAGVAGSASAMDAKTFYEQVDRNHY* |
Ga0066905_1002121883 | 3300005713 | Tropical Forest Soil | KTILSALVALAVIAGVAGTANAAIDAKTFFEQVDRDHN* |
Ga0066905_1002134551 | 3300005713 | Tropical Forest Soil | MKTILTALVALSVIASVAGTASAFDAKDFYAQVDRNHN* |
Ga0066905_1002304592 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGIAGTASAFDTKTFYEQIDRDHN* |
Ga0066905_1002397523 | 3300005713 | Tropical Forest Soil | MKTILSALVALSLIAGVAASASAFDPKAFFDQVDREHN* |
Ga0066905_1002397524 | 3300005713 | Tropical Forest Soil | MKTILSALLALSVIAGVAGSASALDAKSFYEQVDRDHN* |
Ga0066905_1002397525 | 3300005713 | Tropical Forest Soil | MKTILSALVALSLIAGVAGSASALDAKSFYEQVDRDHN* |
Ga0066905_1002965724 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVVGGASAMDAKEFYERVDRNHF* |
Ga0066905_1002965725 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0066905_1003208792 | 3300005713 | Tropical Forest Soil | MKTITSALVALLVIAGVAGAAQAFDTKTFYEQLDRDHN* |
Ga0066905_1003437392 | 3300005713 | Tropical Forest Soil | MKTITSALAALLLIAGVAGSANAFDAKTFYEQVDRDRN* |
Ga0066905_1003466021 | 3300005713 | Tropical Forest Soil | MKTILSTLVALSVIAGVASTASAFDAKSFYEQIDRDHN* |
Ga0066905_1003667801 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN* |
Ga0066905_1003667802 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRNHN* |
Ga0066905_1003667803 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASALDAKTFYEQVDRDHN* |
Ga0066905_1004121202 | 3300005713 | Tropical Forest Soil | MKTITSALVALLVIAGGVATAQAFDAKSFYERLDRTNN* |
Ga0066905_1004517902 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIASVAGQANALDAKTFFEQVDRDHN* |
Ga0066905_1004700303 | 3300005713 | Tropical Forest Soil | MKTITSALVALLLVAGVAGSAQAFDAKDFYEQVDRNHN* |
Ga0066905_1005011182 | 3300005713 | Tropical Forest Soil | IMKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0066905_1005128132 | 3300005713 | Tropical Forest Soil | MKTILSALVVLSVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0066905_1005929812 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVVGSASALDAKTFYEQVDRSHY* |
Ga0066905_1005929813 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVIAGVAGSASALDAKSFYEQVDRNHY* |
Ga0066905_1005978262 | 3300005713 | Tropical Forest Soil | MKTIQCALVALSLFAGVAGSANAFDAKAFYEQVDRDHN* |
Ga0066905_1006035532 | 3300005713 | Tropical Forest Soil | MKTITSALVALLLIAGLASAATALDAKSFYEQVDRNHY* |
Ga0066905_1006035533 | 3300005713 | Tropical Forest Soil | MKTILSALLALSVIAGVAGAASAFDAKTFFEQVDRDHN* |
Ga0066905_1006319881 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVTGTASAFDAKDFYEQVDRNHN* |
Ga0066905_1006617052 | 3300005713 | Tropical Forest Soil | MKSITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN* |
Ga0066905_1007759051 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVIASVAGQANALDAKTFFEQVDRDHN* |
Ga0066905_1010089632 | 3300005713 | Tropical Forest Soil | MKTILSALVVLSVIASVAGTASAFDAKDFYEQVDRNHN* |
Ga0066905_1011233962 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAALDAKTFFEQVDRDHN* |
Ga0066905_1017085762 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKSFYEQVDRDHY* |
Ga0066905_1017085763 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0066905_1018154992 | 3300005713 | Tropical Forest Soil | MKTIVSALVALSVIAGVASAAAAFDAKDFYEQVDRNHN* |
Ga0066905_1018558682 | 3300005713 | Tropical Forest Soil | MKTITSALVALLLIVGVGGAANAFDSKVFYEQMDRDRN* |
Ga0066905_1018739272 | 3300005713 | Tropical Forest Soil | KTILSALIALSVIASVAGQANALDAKTFFEQVDRDHN* |
Ga0066905_1020833391 | 3300005713 | Tropical Forest Soil | MKTILSTLVALSVIAGVASAASAFDTKTFYEQLDREHN* |
Ga0066905_1021971001 | 3300005713 | Tropical Forest Soil | MKTITSALVALLVIAGAAGTANALDAKIFYEQVDRNRN* |
Ga0066905_1022170412 | 3300005713 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0066905_1022170413 | 3300005713 | Tropical Forest Soil | KTILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0066905_1023038252 | 3300005713 | Tropical Forest Soil | MKTILSALVGLSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0066905_1023249481 | 3300005713 | Tropical Forest Soil | MKTILSALIALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0066905_1023249482 | 3300005713 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTANALDAKAFWERIDRDHN* |
Ga0068861_1000270395 | 3300005719 | Switchgrass Rhizosphere | MKTILSALIALSVLAGFAGSAAADVDAKTLYEQMDRDRF* |
Ga0068861_1001234592 | 3300005719 | Switchgrass Rhizosphere | MKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN* |
Ga0068861_1002128644 | 3300005719 | Switchgrass Rhizosphere | MKTILSALIALSVIAGVAGSASAFDAKTFYEQVDRDHN* |
Ga0068861_1014168982 | 3300005719 | Switchgrass Rhizosphere | MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY* |
Ga0068861_1014168983 | 3300005719 | Switchgrass Rhizosphere | MKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN* |
Ga0068861_1021263141 | 3300005719 | Switchgrass Rhizosphere | MITKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN* |
Ga0068861_1021263142 | 3300005719 | Switchgrass Rhizosphere | MKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF* |
Ga0066903_1000535844 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASALDAKTFWEQIDRDHN* |
Ga0066903_1000607286 | 3300005764 | Tropical Forest Soil | MKAITSALVALLVIAGAAGTANALDAKIFYEQVDRNRN* |
Ga0066903_1000658095 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVLAGITGTASAFDAKDFYEQVDRNHN* |
Ga0066903_1001063054 | 3300005764 | Tropical Forest Soil | MKTILCALVALSLFAGVAGSANAFDAKAFYEQVDRDHN* |
Ga0066903_1001310419 | 3300005764 | Tropical Forest Soil | MKTILSALIALSVIASVTGPANALDTKTFFEQIDRDHN* |
Ga0066903_1002044951 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVMAGIAGSASALDAKTFFEQIDRDHN* |
Ga0066903_1003010701 | 3300005764 | Tropical Forest Soil | MKTILSALVALSLIAGVAGSASAFDAKSFYEQVDRDHN* |
Ga0066903_1003010703 | 3300005764 | Tropical Forest Soil | MKTILSALLALSVIAGVAGSASAFDPKAFFDQIDREHN* |
Ga0066903_1004564472 | 3300005764 | Tropical Forest Soil | MKTILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0066903_1006869692 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0066903_1008637033 | 3300005764 | Tropical Forest Soil | MKTITSALVALLVIAGVAGAANAFDAKTFYEQVDRDRN* |
Ga0066903_1011061345 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKTFYEQIDRDHN* |
Ga0066903_1011575852 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVLAGVAGSASAMDAKEFYEQVDRNHF* |
Ga0066903_1011575853 | 3300005764 | Tropical Forest Soil | MKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDH |
Ga0066903_1011873303 | 3300005764 | Tropical Forest Soil | MIGEIAMKTILSALVALSVIAGVAGSACAFDTKTFFEQVDRDHN* |
Ga0066903_1012494632 | 3300005764 | Tropical Forest Soil | MQTILSALVALSLIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0066903_1012494633 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0066903_1012494634 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0066903_1027921791 | 3300005764 | Tropical Forest Soil | MKTIPSALVALLVIAGVAGAANAFDAKTFYEQVDRDRN* |
Ga0066903_1032799192 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTANALDAKTFFEQVDRDHN* |
Ga0066903_1035393711 | 3300005764 | Tropical Forest Soil | MKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0066903_1065653881 | 3300005764 | Tropical Forest Soil | MKTILSALVALSVIAGVAGGASALDAKTFFEQVDRDHN* |
Ga0066903_1066908131 | 3300005764 | Tropical Forest Soil | IAMKTILSALVALSVIAGVAGSASAFDTKTFFEQVDRDHN* |
Ga0066903_1075392462 | 3300005764 | Tropical Forest Soil | GLGALGGEIPMKIILSALVALSVIAGSTIALDARTFFE* |
Ga0068860_1027818672 | 3300005843 | Switchgrass Rhizosphere | TILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY* |
Ga0081455_1000005291 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MHTITSALVALMLITGIAGAAQALDAKGFYERVDRNHN* |
Ga0081455_100000535 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALIALSVIAGVAGTASAFDAKDFYERIDRNHN* |
Ga0081455_1000008715 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALSVIAGVAGSASALDAKTFYEQIDRDHN* |
Ga0081455_1000008716 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRSHY* |
Ga0081455_1000041218 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQTITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN* |
Ga0081455_1000099451 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKSITSALVALLVIAGVAGAAQAFDTKTFYEQVDRNHN* |
Ga0081455_1000868116 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALSVIAGIAGTANALDAKTFFEQVDRDHN* |
Ga0081455_100309791 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALAVIAGVAGSASAMDAKEFYERVDRTHF* |
Ga0081455_100419543 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKSITSALVALLVIAGVADAAQAFDAKTFYEQVDRNHN* |
Ga0081455_106736403 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTILSALIALSILAGFAATASAADLDAKTWFEQMDRSRY* |
Ga0081540_10000716 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTLLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0081540_10000718 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHH* |
Ga0081540_100014852 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALSVIAGVAGSASAFDAKSFYEQIDRNHN* |
Ga0081540_100020536 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTIASALVALSLIAAVAGTAQAFDAKTFYEEVDRNHN* |
Ga0081540_10005156 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VSRLKTILSALVALSVIAGVTGSASALDVKTFYEQVDRNHY* |
Ga0081540_100079426 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTILSALVALSVIAGVAGTANALDAKAFFEQIDRDHN* |
Ga0081540_100109612 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTILSALIALSVLAGFAGSAAADVDAKTFYEQADRDRF* |
Ga0081540_10536952 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTMLSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0081540_10704882 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQTILSALVALSLIAGVVGTASAMDAKTFYEQVDRNHY* |
Ga0081540_10704883 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKIILSALVALSVIAGVTGSASALDAKTFFEQVDRDHN* |
Ga0081540_11659452 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKTITSALVALLVIASVAGTAQAFDAKTFYEQVDRNHN* |
Ga0075417_102354653 | 3300006049 | Populus Rhizosphere | MKTILSALVALSVIAGVAGGTVAMDAKEFYERVDRNHF* |
Ga0070715_100108007 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTSLSVLAALSVIAGVADTASAFDAKTFYEQVDRDHN* |
Ga0070715_101849964 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSALVALSVLAGVAGSASAFDAKSFYEQVDRNHY* |
Ga0070715_101849965 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY* |
Ga0070716_1005057182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNAMKTILSALVALSVVAGVAGTANALDAKIFFEQVDRDHN* |
Ga0070712_1008536063 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY* |
Ga0075422_100286742 | 3300006196 | Populus Rhizosphere | MKTILSALVALSVIAGAAGAAIAFDAKDFYERIDRNHN* |
Ga0075422_100329132 | 3300006196 | Populus Rhizosphere | MKTITSALLALLVIAGVAGAAEALDAKTFYAQVDRNHN* |
Ga0075422_100443493 | 3300006196 | Populus Rhizosphere | MKTVLSALIALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0075422_101166242 | 3300006196 | Populus Rhizosphere | MKTITSALVALVLLTGIAGSAQALDARSFYDQVDRNHN* |
Ga0075422_104448062 | 3300006196 | Populus Rhizosphere | MKTILSALLALSVLAGFAGTAAAAVDAKTFYDQVDRDRF* |
Ga0075422_104915403 | 3300006196 | Populus Rhizosphere | MKTILSALIALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0079222_100521022 | 3300006755 | Agricultural Soil | MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0079222_104412892 | 3300006755 | Agricultural Soil | MKTILSALIALSVIAGVAGSASAFDAKDFYEQVDRNHN* |
Ga0079222_107760331 | 3300006755 | Agricultural Soil | MKTILSTLIAQSVLAGFAGTAAANVDAKTFYEQVVRDSL* |
Ga0079222_108320792 | 3300006755 | Agricultural Soil | MIMKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN* |
Ga0079222_108720213 | 3300006755 | Agricultural Soil | MKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN* |
Ga0079222_111407282 | 3300006755 | Agricultural Soil | MKTILSALVVLSVVAGVAGTANAAIDAKTFFEQVDRDHN* |
Ga0075428_1000120558 | 3300006844 | Populus Rhizosphere | MKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN* |
Ga0075428_1000416767 | 3300006844 | Populus Rhizosphere | MKTILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0075428_1002044445 | 3300006844 | Populus Rhizosphere | MKTILSALVALSVVASVAGPANALDAKTFFEQVDRDHN* |
Ga0075428_1002639694 | 3300006844 | Populus Rhizosphere | MKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0075428_1005370271 | 3300006844 | Populus Rhizosphere | KRRMIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0075428_1006845793 | 3300006844 | Populus Rhizosphere | MKTILSALIALSVLAGFAGTAAANVDAKTFYDQVDRDHF* |
Ga0075428_1020107391 | 3300006844 | Populus Rhizosphere | MKTILSALVALSVIAGIAGSASAFDAKTFYEQVDRDHN* |
Ga0075428_1020836831 | 3300006844 | Populus Rhizosphere | MQTITSALVALVLLTGIVGSAQALDARDFYEQVDRYHH* |
Ga0075431_1001600452 | 3300006847 | Populus Rhizosphere | MKTILSALVALSVIAGVAGTANALDAKTFFEQVDRNHN* |
Ga0075433_1000143616 | 3300006852 | Populus Rhizosphere | MKTVLSALIALSVIASVAGTASALDAKTFFEQVDRDHN* |
Ga0075433_100033518 | 3300006852 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASALDAKTFYQQVDRDHY* |
Ga0075433_100054383 | 3300006852 | Populus Rhizosphere | MKTITSALLALLVIAGVAGAAEAIDAKAFYEQVDRNHN* |
Ga0075433_100133266 | 3300006852 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN* |
Ga0075433_102510823 | 3300006852 | Populus Rhizosphere | MQTITSAVVALLLVAGVAGAAQALDAKTFYEEVDRNHN* |
Ga0075433_103224822 | 3300006852 | Populus Rhizosphere | MKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRDHN* |
Ga0075433_103582131 | 3300006852 | Populus Rhizosphere | MKTILSALVALSVIAGAAGTASALDAKTFFEQIDRDHN* |
Ga0075433_118298762 | 3300006852 | Populus Rhizosphere | MIMKTILSALIALSVIAGVAGTANALDAKTFFEQVDRDHN* |
Ga0075425_1000043206 | 3300006854 | Populus Rhizosphere | MKTILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN* |
Ga0075425_1001167582 | 3300006854 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASAFDARTFYEQVDRDHN* |
Ga0075425_1008111372 | 3300006854 | Populus Rhizosphere | MKTILSALVALSVIAGASATASALDAKSFYEQVDRTHYAK |
Ga0075434_1000126761 | 3300006871 | Populus Rhizosphere | IAMKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN* |
Ga0075434_1021737281 | 3300006871 | Populus Rhizosphere | MNGEIAMKTITSALVALLVIAGIAGTAQAFDAKTFYEQVDRNHN* |
Ga0075434_1025768432 | 3300006871 | Populus Rhizosphere | MKTITSALVALVLLTGIAASAQALDARSFYDLVDRNHN* |
Ga0075429_1016457711 | 3300006880 | Populus Rhizosphere | QRRDAMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0075426_102154981 | 3300006903 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDR |
Ga0075424_10000132223 | 3300006904 | Populus Rhizosphere | LSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN* |
Ga0075424_1000119299 | 3300006904 | Populus Rhizosphere | MKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN* |
Ga0075424_1000981962 | 3300006904 | Populus Rhizosphere | MKTIMSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0075424_1009299511 | 3300006904 | Populus Rhizosphere | MKTILAALIALSVIASVAGQANALDAKTFFEQVDRDHN* |
Ga0075424_1020526121 | 3300006904 | Populus Rhizosphere | EEIAMKTILSALVALSFIAGVAGTANALDAKTFFEQVDRDHN* |
Ga0075424_1025735392 | 3300006904 | Populus Rhizosphere | MKTILSALIALSVLAGFAGTAAANVDTKTFYEQVD |
Ga0081243_10083633 | 3300006937 | Tropical Rainforest Soil | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDR |
Ga0079219_101110112 | 3300006954 | Agricultural Soil | MKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN* |
Ga0079219_105440522 | 3300006954 | Agricultural Soil | MKTIVSALIALSVIAGIAAPASALDAKSFYEQVDRLHY* |
Ga0079219_106186892 | 3300006954 | Agricultural Soil | MKTILSALVALSVIAGIAGSANALDAKTFFEQVDRNHN* |
Ga0079219_114094812 | 3300006954 | Agricultural Soil | MKTILSVLVALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0105098_102881981 | 3300009081 | Freshwater Sediment | MKTILSALIALSVIAGVASTARAMDAKEFYERVDRNHF* |
Ga0111539_100100443 | 3300009094 | Populus Rhizosphere | MIMKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0111539_100149254 | 3300009094 | Populus Rhizosphere | MITKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0111539_101629353 | 3300009094 | Populus Rhizosphere | MIMKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN* |
Ga0111539_101677671 | 3300009094 | Populus Rhizosphere | MIMKTILSALVAFSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0111539_101865653 | 3300009094 | Populus Rhizosphere | MKTILSALIALSVIASVAGPANALDAKTFFEQVYRDHN* |
Ga0111539_101935721 | 3300009094 | Populus Rhizosphere | MKTILSALIALSVIAGVAGTANALDAKTFWEQMDRDHN* |
Ga0111539_102574102 | 3300009094 | Populus Rhizosphere | MKTILSALVALSLIAGVAGSASAFDAKDFYELVDRNHN* |
Ga0111539_103036272 | 3300009094 | Populus Rhizosphere | MIMKTILSALVALSVIASVAGTANALDAKTFWEQVDRDHN* |
Ga0111539_104200892 | 3300009094 | Populus Rhizosphere | MIMKTILSALIALSVIAGIAGSASALDAKTFYEQVDRNHN* |
Ga0111539_104956782 | 3300009094 | Populus Rhizosphere | MKTILSALVALSVMAGVAGSASALDAKTFFEQVDRDHN* |
Ga0111539_106404342 | 3300009094 | Populus Rhizosphere | MKTILSALVALSVIAGVAGAAVAMDAKEFYERVDRNHF* |
Ga0111539_106921311 | 3300009094 | Populus Rhizosphere | MIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRNHY* |
Ga0111539_116396592 | 3300009094 | Populus Rhizosphere | MKNILSALIALSLIAGVAGGAVAMDAKEFYERVDRNHF* |
Ga0111539_123183821 | 3300009094 | Populus Rhizosphere | KTKKRRMIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRDHN* |
Ga0111539_123852051 | 3300009094 | Populus Rhizosphere | MKTITSALVALLVIAGITGRANAFDAKTFYEQIDRDHN* |
Ga0105245_119756911 | 3300009098 | Miscanthus Rhizosphere | MKTILSALVALSVIASVAGPANAFDAKTFFEQVDRDHN* |
Ga0075418_100339394 | 3300009100 | Populus Rhizosphere | MIMKTILSALVALSVVASVAGPANALDAKTFFEQVDRDHN* |
Ga0075418_100552763 | 3300009100 | Populus Rhizosphere | MKTILSALLALSVLAGFAGTAAANVDAKTFYEQVDRDRF* |
Ga0075418_104515442 | 3300009100 | Populus Rhizosphere | MNGEIAMKTITSALVALLVIAGVAGTAQALDAKTFYEQVDRNHN* |
Ga0075418_105699561 | 3300009100 | Populus Rhizosphere | TILSALVALSVLAGVAGSASALDAKTFYEQVDRDHY* |
Ga0075418_105699562 | 3300009100 | Populus Rhizosphere | MIMKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN* |
Ga0075418_110864362 | 3300009100 | Populus Rhizosphere | ILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0075418_122410901 | 3300009100 | Populus Rhizosphere | MTGDVAMQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN* |
Ga0075418_126628871 | 3300009100 | Populus Rhizosphere | MQTITSAAFIALMLLTGIAGAAQALDAKSFYEQVDRSHN* |
Ga0105091_101249371 | 3300009146 | Freshwater Sediment | MKTITSALVALLVITGATGTASAFDAKTFYEQVDRNHN* |
Ga0105091_104425221 | 3300009146 | Freshwater Sediment | MKAKGETAMQTILSALVALLVIAGVAGAAHALDAKSFYEEIDRTHY* |
Ga0105091_104707512 | 3300009146 | Freshwater Sediment | MKTILSALIALSVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0114129_100687881 | 3300009147 | Populus Rhizosphere | MKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN* |
Ga0114129_101793242 | 3300009147 | Populus Rhizosphere | MKTIMSAVVALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0114129_101948902 | 3300009147 | Populus Rhizosphere | MQTITSALVALVLLTGIASSAQALDARSFYEQVDRNHN* |
Ga0114129_103323034 | 3300009147 | Populus Rhizosphere | MIMKTILSALVALSVVASVAGPANALDAKTFFEQVDRGHN* |
Ga0114129_124099271 | 3300009147 | Populus Rhizosphere | ILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0111538_100703403 | 3300009156 | Populus Rhizosphere | MKTIMSALVALSVIASVAGQANALDAKTFFEQVDRDHN* |
Ga0111538_101555271 | 3300009156 | Populus Rhizosphere | TITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN* |
Ga0111538_102380094 | 3300009156 | Populus Rhizosphere | DAMKTILSALVALSVIASVAGGAVAMDAKEFYERVDRNHF* |
Ga0111538_102498781 | 3300009156 | Populus Rhizosphere | MIMKTILSAFVALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0111538_102793941 | 3300009156 | Populus Rhizosphere | MKIILSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0111538_102808375 | 3300009156 | Populus Rhizosphere | MIMKTILSALVALSVLAGVAGSASALDAKAFYEQVDRDHN* |
Ga0111538_104148141 | 3300009156 | Populus Rhizosphere | TILSALIALSVIAGVAGSASALDAKTFYEQVDRNHN* |
Ga0111538_107160922 | 3300009156 | Populus Rhizosphere | MIMKTILSALVALSVIAGVAGTANALDAKSFYEQVDRDHY* |
Ga0111538_113581892 | 3300009156 | Populus Rhizosphere | SRIRGEIAMKTILSALVALSVIAGVAGSASAFDAKTFYEPVDRDHN* |
Ga0111538_115307402 | 3300009156 | Populus Rhizosphere | MKTITSALLALLVIAGVAGAAEALDAKAFYEQVDRNHN* |
Ga0111538_117827252 | 3300009156 | Populus Rhizosphere | MNTTMSALVALLVIAGVAGSAKAFDAKTFYEQVERDRN* |
Ga0111538_122147673 | 3300009156 | Populus Rhizosphere | MIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0111538_122147674 | 3300009156 | Populus Rhizosphere | TMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0075423_100109232 | 3300009162 | Populus Rhizosphere | MKTVLSALIALSVIASVGGTASALDAKTFFEQVDRDHN* |
Ga0105241_109460312 | 3300009174 | Corn Rhizosphere | MKTILSALLAHSVIASVVGPANALDAKTFFEQVDRDHN* |
Ga0105241_116311442 | 3300009174 | Corn Rhizosphere | MTMKTILSALVALSAIASVAGTANALDAKTFFEQVDRDHN* |
Ga0105241_126544292 | 3300009174 | Corn Rhizosphere | SNKKRRMIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHN* |
Ga0126374_100187082 | 3300009792 | Tropical Forest Soil | MRTIASALLALLVIVGIAGSADAFDAKSFYQQVDRDHN* |
Ga0126374_101219003 | 3300009792 | Tropical Forest Soil | MIMKTILSALVAISVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0126374_102337312 | 3300009792 | Tropical Forest Soil | MNTILSALVALSVIAGVAGTANAFDAKSFYEQVDRNHN* |
Ga0126374_102869871 | 3300009792 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASALDAKSFYEQVDRD |
Ga0126374_102869872 | 3300009792 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKTFYEQVDRNHN* |
Ga0126374_103595103 | 3300009792 | Tropical Forest Soil | MIMKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDH |
Ga0126374_108830822 | 3300009792 | Tropical Forest Soil | MIMKTILSAIVALSVIAGVAGSASAALDAKTFFEQVDRDHN* |
Ga0126374_116402221 | 3300009792 | Tropical Forest Soil | MKSILSALVALSVIAGVAGLASAFDAKTFYEQIDRNGN* |
Ga0126380_100204138 | 3300010043 | Tropical Forest Soil | MKTILSALVAFSVIGGIAGSAKALDAKTFYEQVDRNHYAKNDD |
Ga0126380_100223416 | 3300010043 | Tropical Forest Soil | MKTITSAFVALLVIAAVAGSASAFDAKTFYEQVDRNHN* |
Ga0126380_100632243 | 3300010043 | Tropical Forest Soil | MKTILSAVVALSVIAGVTGTVSAFDAKDFYEQVDRNHN* |
Ga0126380_101734512 | 3300010043 | Tropical Forest Soil | MKTILSALLALSMIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0126380_102892492 | 3300010043 | Tropical Forest Soil | MKTILSLIALSVIAATAGTASAFDAKDFYEQVDRNHN* |
Ga0126380_104788642 | 3300010043 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASALDAKAFFEQIDRDHN* |
Ga0126384_1000011135 | 3300010046 | Tropical Forest Soil | IMKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN* |
Ga0126384_1000055626 | 3300010046 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSARALDAKIFFEQVDRDHN* |
Ga0126384_100324554 | 3300010046 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN |
Ga0126384_101738364 | 3300010046 | Tropical Forest Soil | MKTILSALVALSVIASSASALDAKTFFEQVDRDHN* |
Ga0126384_121594091 | 3300010046 | Tropical Forest Soil | MKAILSALVALSVIAGVAGSASALDAKTFYEQVDRNHN* |
Ga0126384_121594092 | 3300010046 | Tropical Forest Soil | MIMKTILSALIALSVIAGVAGSASALDAKSFYEQVDRNHN* |
Ga0126382_100103032 | 3300010047 | Tropical Forest Soil | MIMKTILSALVALSLIAGVAASASAFDPKAFFDQVDREHN* |
Ga0126382_100103033 | 3300010047 | Tropical Forest Soil | MIMKTILSALLALSVIAGVAGSASALDAKSFYEQVDRDHN* |
Ga0126382_100103594 | 3300010047 | Tropical Forest Soil | MKIILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0126382_100116135 | 3300010047 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSSSAMDAKEFYEQVDRNHF* |
Ga0126382_100201137 | 3300010047 | Tropical Forest Soil | LSALVALSLIAGVAGSASALDAKSFYEQVDRDHY* |
Ga0126382_100378283 | 3300010047 | Tropical Forest Soil | MKTILSALVALAVIAGVAGTASAFDPKAFYEQIDRDHN* |
Ga0126382_100508533 | 3300010047 | Tropical Forest Soil | MKTILSALVALSVITGVAGTASAFDARTFYEQIDRDHN* |
Ga0126382_100516845 | 3300010047 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSANALDAKTFFEQVDRDHN* |
Ga0126382_100577615 | 3300010047 | Tropical Forest Soil | MIMKTILSALLALSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0126382_101662671 | 3300010047 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSARALDAKTFFEHVDRDHN* |
Ga0126382_102200473 | 3300010047 | Tropical Forest Soil | MIMKTILSALVALSLIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0126382_102500671 | 3300010047 | Tropical Forest Soil | MKTITSALVALLVIAGAAGIANALDAKTLYEQVDRNRN* |
Ga0126382_103897001 | 3300010047 | Tropical Forest Soil | MKTITSALVALVLLTGITGSAHALDAKSFYEQVDRKHN* |
Ga0126382_105483301 | 3300010047 | Tropical Forest Soil | MKTMLSALVALSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0126382_105483302 | 3300010047 | Tropical Forest Soil | MKAILSTLLALSVIAGVAGSASALDAKTFYEQVDRNHY* |
Ga0126382_106146372 | 3300010047 | Tropical Forest Soil | MIMKIILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0126382_106616891 | 3300010047 | Tropical Forest Soil | MKTVLSAFVAVLVMAGVAGTASAIDAKTFYEQVDRNHY* |
Ga0126382_106649203 | 3300010047 | Tropical Forest Soil | RGEIAMKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN* |
Ga0126382_107452763 | 3300010047 | Tropical Forest Soil | MIMKTILSALVALSVVTGVAGTANALDAKTFWEQIDRDHN* |
Ga0126382_112409582 | 3300010047 | Tropical Forest Soil | MIMRTILSALVALSVIAGVAGSASALDAKSFYEQVDRNHY* |
Ga0126382_115465132 | 3300010047 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSANALDAKAFFEQIDRDHN* |
Ga0126382_120361691 | 3300010047 | Tropical Forest Soil | MKTILSALIALSVLAGFVGSAAADVDAKALYEQMDRDRF* |
Ga0126382_120554661 | 3300010047 | Tropical Forest Soil | MKTITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN* |
Ga0126382_121981981 | 3300010047 | Tropical Forest Soil | MKTITSALVALLVIAGVAGAAQASDAKSFYEQVDRNHN* |
Ga0126370_113243881 | 3300010358 | Tropical Forest Soil | KTMLSALVALSVIAGVAGSASAMDAKEFYEQVDRNHF* |
Ga0126370_113243882 | 3300010358 | Tropical Forest Soil | MIMKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDHN* |
Ga0126370_121318742 | 3300010358 | Tropical Forest Soil | MKILLSALLALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0126376_100076038 | 3300010359 | Tropical Forest Soil | MKTILSALIALSVIAATAGTASAFDAKDFYEQVDRNHN* |
Ga0126372_101869751 | 3300010360 | Tropical Forest Soil | LSALVALSVIAGVAGSASALDAKTFFEQIDRNHN* |
Ga0126372_103167683 | 3300010360 | Tropical Forest Soil | MKTITSALVALLLIAGVAGAAQALDAKTFYEQVDRNHN* |
Ga0126372_104672032 | 3300010360 | Tropical Forest Soil | VKAILSALVGLSVIAGVAGNASALDAKTFFEQVVSDRN* |
Ga0126372_108494581 | 3300010360 | Tropical Forest Soil | MKTSLSALVALLVIAGAAGTASALDAKTFFEQIDRDHN* |
Ga0126372_116103392 | 3300010360 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDTKTFYEQLDRERNYR* |
Ga0126372_122343011 | 3300010360 | Tropical Forest Soil | ILSALVALAVIAGVAGSASAFDTKTFYEQIDRDHN* |
Ga0126372_124339962 | 3300010360 | Tropical Forest Soil | MIMKTILSALVALSVMAGVAGSASALDAKTFFEQIDRDHN* |
Ga0126377_1000225211 | 3300010362 | Tropical Forest Soil | MKTILSALVAVSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0126377_100076513 | 3300010362 | Tropical Forest Soil | MIMKLILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0126377_100076514 | 3300010362 | Tropical Forest Soil | MKTILSALVALLVIAGVAGSASAMDAKAFYEQVDRNHY* |
Ga0126377_100099019 | 3300010362 | Tropical Forest Soil | MKTMLCALVALSVIAGVTGTASAFDAKDFYERVDRNHN* |
Ga0126377_100200591 | 3300010362 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGPANALDAKTFFEQIDRDHN* |
Ga0126377_100304603 | 3300010362 | Tropical Forest Soil | MKTITSALFALLLIAGVAGTAQAYDAKAFFEQVDRNHN* |
Ga0126377_100896992 | 3300010362 | Tropical Forest Soil | MKTITSALVALLVIATVAGTAQAFDAKTFYEQVDRNHN* |
Ga0126377_101100642 | 3300010362 | Tropical Forest Soil | MKTITSALVALLVIAGVAGTAQALDAKTFYEQIDRNHN* |
Ga0126377_102675424 | 3300010362 | Tropical Forest Soil | MKSILSALVALSVIAGVAGSASAFDAKTFYEQIDRNGN* |
Ga0126377_103508422 | 3300010362 | Tropical Forest Soil | MKTILSALLALSVIAGVAGSASAMDAKEFYEQVDRNHY* |
Ga0126377_103660683 | 3300010362 | Tropical Forest Soil | MKTILSALVALSLIAGVAGSANAFDAKAFYEQVDRDHN* |
Ga0126377_105414661 | 3300010362 | Tropical Forest Soil | MKTIVSALVALAVIAGVAGTANAAIDAKTFFEQVDRDHN* |
Ga0126377_106465972 | 3300010362 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGTATALDAKTFWEQIDRNHN* |
Ga0126377_106563823 | 3300010362 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGTANALDAKAFWERIDRDHN* |
Ga0126377_106989621 | 3300010362 | Tropical Forest Soil | MKTILSALIALSVIAGVAGAASALDAKTFYEQVDRNHY* |
Ga0126377_109945351 | 3300010362 | Tropical Forest Soil | MKTILSALVALSVIAGVAGSASAMDAREFYERVDRNHF* |
Ga0126377_109945352 | 3300010362 | Tropical Forest Soil | MIMKTILSALVALSVIAGAAGTANALDAKTFWEQIDRDHN* |
Ga0126377_110921821 | 3300010362 | Tropical Forest Soil | TILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN* |
Ga0126377_111920451 | 3300010362 | Tropical Forest Soil | MKTILSAMIALSVLAGFAGSAAADVDAKTFYEQADRDRY* |
Ga0126377_119585111 | 3300010362 | Tropical Forest Soil | SALIALSVLAGFAGTAAANVDAKTFYEQVDRDRF* |
Ga0126377_119977512 | 3300010362 | Tropical Forest Soil | MKTITSALAALLLITGVAGSAHAFDAKTFYEQVDRDRN* |
Ga0126377_120087111 | 3300010362 | Tropical Forest Soil | KRRMIMKTILSALVALSVIAGVAGSATALDAKTFFEQIDRDHN* |
Ga0126377_127590831 | 3300010362 | Tropical Forest Soil | MKAILSTLVALSVIASVTGPANALDAKTFFEQVDRNHN* |
Ga0126377_129668902 | 3300010362 | Tropical Forest Soil | MIMKTILSALIALSVIAGVAGSASAFDARAFYEQIDRNHN* |
Ga0126377_131044141 | 3300010362 | Tropical Forest Soil | MKTILSALIALSVVAGVAGTASAFDAKDFYERIDRNHN* |
Ga0126377_132759241 | 3300010362 | Tropical Forest Soil | LGALRGEIAMKIILSALLALSVIAGVAGSASAMDAREFYERVDRNHF* |
Ga0126377_134528731 | 3300010362 | Tropical Forest Soil | AMKIILSALVALSLIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0126379_114421882 | 3300010366 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0126379_114421883 | 3300010366 | Tropical Forest Soil | MIMKTILSALVALSVIAGAAGSASALDAKTFYEQVDRNHY* |
Ga0126379_114421884 | 3300010366 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDH |
Ga0134125_108364051 | 3300010371 | Terrestrial Soil | MIMKTILSALVALSVIASVAGTANALDAKSFFEQV |
Ga0134125_126625823 | 3300010371 | Terrestrial Soil | DGKKRRAPMKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF* |
Ga0134126_108927802 | 3300010396 | Terrestrial Soil | MKTILSALIALSVIASVAGSASALDAKTFYEQVDRDHN* |
Ga0134126_112215571 | 3300010396 | Terrestrial Soil | MIMKTILSALIVLSVIASVAGSASALDAKTFYEQVDSNHF* |
Ga0134127_134609161 | 3300010399 | Terrestrial Soil | MKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF* |
Ga0134122_100030245 | 3300010400 | Terrestrial Soil | MIMKTILSALIALSVIASVAGSASALDAKTFYEQVDSNHF* |
Ga0134122_100030246 | 3300010400 | Terrestrial Soil | MIMKTILSALIALSVIASVAGSASAFDAKTFYEQVDRDHN* |
Ga0134122_111635553 | 3300010400 | Terrestrial Soil | MKTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHR* |
Ga0134122_133569033 | 3300010400 | Terrestrial Soil | MKTILSALIAFSVIAGVAGSASALDAKTFYEQVDR |
Ga0134123_133027251 | 3300010403 | Terrestrial Soil | MKTILSALVALSVIASATGPANALDAKTFFEQVDRD |
Ga0134123_133835461 | 3300010403 | Terrestrial Soil | MTMKTILSALVALSAIASVAGTANALDAKSFFEQVDRDHN* |
Ga0157337_10059591 | 3300012483 | Arabidopsis Rhizosphere | MKTILSALVGLSVIAGIAGSASAFDAKTFYEQVDRDHN* |
Ga0157331_10380212 | 3300012486 | Soil | MIMKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0157335_10230701 | 3300012492 | Arabidopsis Rhizosphere | MKTILSALVALSVIAGVVGAAVAMEAKEFYERVDRNHF* |
Ga0157355_10425552 | 3300012493 | Unplanted Soil | EIAMKTILSALIALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0157313_10608802 | 3300012503 | Arabidopsis Rhizosphere | RRDIMKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF* |
Ga0157326_10670641 | 3300012513 | Arabidopsis Rhizosphere | MKTILSALVALSVIASVVGPANALDAKTFFEQVDRDHN* |
Ga0126375_100050193 | 3300012948 | Tropical Forest Soil | MKTILSALVALSLIAGFAGGASAMDAKEFYEQVDRNHY* |
Ga0126375_100050194 | 3300012948 | Tropical Forest Soil | MIMKTILSALIALAVIAGVAGSASALDAKTFFEQIDRDHN* |
Ga0126375_100720155 | 3300012948 | Tropical Forest Soil | MKTILSALVALSVIAGVAGTASAFDAKSFYEQIDRNHN* |
Ga0126375_101051423 | 3300012948 | Tropical Forest Soil | MIMKTILSALVGLSVIAGVAGSASALDAKTFYEQVDRDHN* |
Ga0126375_101398133 | 3300012948 | Tropical Forest Soil | MIMKTILSALLALSVIAGVAGSASALDAKSFYEQVDR |
Ga0126375_101795841 | 3300012948 | Tropical Forest Soil | DQREIAMKTILSALIALSVIAATAGTASAFDAKDFYEQVDRNHN* |
Ga0126375_102162503 | 3300012948 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGSASAMDTKEFYERVDRNHF* |
Ga0126375_102162504 | 3300012948 | Tropical Forest Soil | MKTILSALIAISVIAGVAGSASAMDTKEFYERVDRNHF* |
Ga0126375_104055122 | 3300012948 | Tropical Forest Soil | MIMKIILSALVALSVIAGVAASASALDAKTFFEQVDRDHN* |
Ga0126375_104785832 | 3300012948 | Tropical Forest Soil | MKTILSALVALSVIAGVVGSASAMDAKEFYERVDRNHF* |
Ga0126375_108526671 | 3300012948 | Tropical Forest Soil | EIAVKTVLSALVALSVIAGVASTASAFDAKSFYEQIDRDHN* |
Ga0126375_110204261 | 3300012948 | Tropical Forest Soil | MKTSLSALVAPLVIAGAAGTASALDAKTFFEQIDRDHN* |
Ga0126375_112313972 | 3300012948 | Tropical Forest Soil | MKTILSALVALSVIANVAGPANALDAKTFFEQVDRDHN* |
Ga0126375_113870831 | 3300012948 | Tropical Forest Soil | KTITSALVALLVIAGAAGIANALDAKTLYEQVDRNRN* |
Ga0126375_119835182 | 3300012948 | Tropical Forest Soil | MKTILSALVALSFFAGVAGSANAFDAKAFYEQVDRDHN* |
Ga0164303_109820501 | 3300012957 | Soil | MKTSLAALGALSVIAGIAGTASALDAKTFYEQVDRDHY* |
Ga0164301_108267402 | 3300012960 | Soil | MKTTILSVLAALSVIAGVADTASAFDAKTFYEQVDRDH |
Ga0126369_108931433 | 3300012971 | Tropical Forest Soil | MIMKTILSALVALSVIAGVAGTANALDAKTFWEQIDRDHN* |
Ga0164304_103238551 | 3300012986 | Soil | MKTILSALVALSVVAGVAGTANALDAKTFFEQVDRDHN* |
Ga0132258_1000152930 | 3300015371 | Arabidopsis Rhizosphere | MIMKTILSALVALSVIAGVAGAASALDAKTFYEQVDRDHN* |
Ga0132258_1000303528 | 3300015371 | Arabidopsis Rhizosphere | MKTITSALVVLLVIAGVAGSASAFDAKDFYEQVDRNHN* |
Ga0132258_1000361833 | 3300015371 | Arabidopsis Rhizosphere | MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFYEQLDRNHN* |
Ga0132258_1000361834 | 3300015371 | Arabidopsis Rhizosphere | MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFYEQADRNHN* |
Ga0132258_1000597613 | 3300015371 | Arabidopsis Rhizosphere | MKTITSVLVALVLLTGITGSAKALDARSFYDQVDRNHN* |
Ga0132258_1001051321 | 3300015371 | Arabidopsis Rhizosphere | MIMKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN* |
Ga0132258_1001364913 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALLALSVLAGFAGTAAADVDAKTFYETVDRDRF* |
Ga0132258_100249319 | 3300015371 | Arabidopsis Rhizosphere | MTGDVAMQTITSALIALLLVAGLASTAQALDAKTFYGEVDRNRN* |
Ga0132258_100786253 | 3300015371 | Arabidopsis Rhizosphere | MKAILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN* |
Ga0132258_101360804 | 3300015371 | Arabidopsis Rhizosphere | MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRDHN* |
Ga0132258_103242192 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALVALSVIAGIAGGAVAMDAKEFYERVDRNHF* |
Ga0132258_103377807 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALLAHSVIASVVGPANALDATTFFEQVDRDHN* |
Ga0132258_113571511 | 3300015371 | Arabidopsis Rhizosphere | MMMKTILSALVALSVIAGVGGSASALDAKTFFEQIDRDHN* |
Ga0132258_113571512 | 3300015371 | Arabidopsis Rhizosphere | MKTLLSALVALSVIAGVAGTASAMDAKEFYERVDRNHF* |
Ga0132258_113764533 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALIALSVIAGTASAFDAKSFYEQVDREHN* |
Ga0132258_116570971 | 3300015371 | Arabidopsis Rhizosphere | MQTITSASVALLVIAGAVGTAKAFDAKIFYEQVDRNRN* |
Ga0132258_122158712 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALVALSIIAGVAGSASAFDAKTFYEQVDRDHN* |
Ga0132258_123001382 | 3300015371 | Arabidopsis Rhizosphere | MKRILSVLVALSVIAGVAGSASAMDAKEFYERVDRNHF* |
Ga0132258_123001383 | 3300015371 | Arabidopsis Rhizosphere | MMMKTILSALVALSVIAGLAGTANALDARTFWEQIDRDHN* |
Ga0132258_125814254 | 3300015371 | Arabidopsis Rhizosphere | MKTILSALVALSVIASVTGPANALDAKTFFEQVDRDHN* |
Ga0132256_1011803052 | 3300015372 | Arabidopsis Rhizosphere | MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDRNHN* |
Ga0132256_1021233382 | 3300015372 | Arabidopsis Rhizosphere | MKTITSALLALLVIAGVAGAVEALDAKTFYEQVDRNHN* |
Ga0132256_1024180551 | 3300015372 | Arabidopsis Rhizosphere | MIMKTMLSALVALSVIASVAGPANALDAKTFFEQVDRDHN* |
Ga0132257_1008365473 | 3300015373 | Arabidopsis Rhizosphere | MKTILSALIALSVIASVAGPANVLDAKTFFEQVDRDHN* |
Ga0132257_1010631021 | 3300015373 | Arabidopsis Rhizosphere | MKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN* |
Ga0132257_1015883063 | 3300015373 | Arabidopsis Rhizosphere | MIMKTILSALIALSVIAGVAVSASALDAKTFYEQVDRNHY* |
Ga0132255_1000815553 | 3300015374 | Arabidopsis Rhizosphere | MIMKTILSALVALSVIAGVAGAASALDAKTFYEQVDRNHY* |
Ga0132255_1004529952 | 3300015374 | Arabidopsis Rhizosphere | MKPITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN* |
Ga0132255_1007220432 | 3300015374 | Arabidopsis Rhizosphere | MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFFEQADRNHN* |
Ga0132255_1018763682 | 3300015374 | Arabidopsis Rhizosphere | MKTILSALVALSVIAGVAGGAAAMDAKEFYERVDRNHF* |
Ga0132255_1058481931 | 3300015374 | Arabidopsis Rhizosphere | RGEIAMKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN* |
Ga0182038_109495092 | 3300016445 | Soil | MKTIVLAFITLSVLAGIVGSASALDAKTFYEQQDRAQN |
Ga0163161_104613041 | 3300017792 | Switchgrass Rhizosphere | MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNH |
Ga0187783_103513242 | 3300017970 | Tropical Peatland | MKTILAALIVLSALAGVAGSASALDPKGFYDQQDRSRW |
Ga0187783_104394692 | 3300017970 | Tropical Peatland | MKTIILALFTLSVLAGITGSASALDAKTFYEQQDRAHY |
Ga0184612_101467872 | 3300018078 | Groundwater Sediment | MKTIVSALIALSVITSVSAPASAFDAKTFFEQVDRNQP |
Ga0184625_102268981 | 3300018081 | Groundwater Sediment | MKTILSALVALSVLAGITGPLAAADDAKIFWEQQDRARY |
Ga0190272_120832111 | 3300018429 | Soil | IVSALLALSVIAGVATSASALDAKTFYEQVDKSHF |
Ga0190272_120832112 | 3300018429 | Soil | MKTIVSALLALSVIAGVATSASALDAKTFYEQQDKGRF |
Ga0190270_115606141 | 3300018469 | Soil | MKTILSALVALSVLAGISGPLAAADDAKIFWEQQDRARH |
Ga0190274_129438171 | 3300018476 | Soil | RRTAMKTIVSALIALSVIAGVAAPASALDAKTFWQQQDASHN |
Ga0180106_11591324 | 3300019212 | Groundwater Sediment | QKEMIMKAILSALVALSVVTGAAASANAFDAKTFYEQLDSVRS |
Ga0184645_11336444 | 3300019233 | Groundwater Sediment | MKTIVSALIALSVIAGIAAPASASVDAKAFYEKLDRSVN |
Ga0184645_12325312 | 3300019233 | Groundwater Sediment | MKTILSALIALSVVAGVASAPASAFDAKTFYEQRDQAGIN |
Ga0184645_12325313 | 3300019233 | Groundwater Sediment | MKTILSALVALTVIAGVASAPASALDARQFYNQVDTAGIN |
Ga0190264_107053872 | 3300019377 | Soil | MKTIVSALLALSVIAGVATSASALDAKTFYEQVDKSHF |
Ga0242660_12481661 | 3300022531 | Soil | NRRKVMKTILSALLALSVIAGVATSASALDAKTFYTQQDASRY |
Ga0242662_101678371 | 3300022533 | Soil | ALAPIRRTIMKIILSALFDLSVLAGVATSASALDAKAFYQQVDHNGQPG |
Ga0207654_105027771 | 3300025911 | Corn Rhizosphere | MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDRNHN |
Ga0207663_102423052 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSVLAALSVIAGVADTASAFDAKTFYEQVDRDH |
Ga0207690_112730711 | 3300025932 | Corn Rhizosphere | MKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF |
Ga0207706_108934532 | 3300025933 | Corn Rhizosphere | MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN |
Ga0207709_112824932 | 3300025935 | Miscanthus Rhizosphere | MKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN |
Ga0207665_105533971 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNAMKTILSALVALSVVAGVAGTANALDAKIFFEQVDRDHN |
Ga0207668_106297131 | 3300025972 | Switchgrass Rhizosphere | MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY |
Ga0207668_106297132 | 3300025972 | Switchgrass Rhizosphere | MKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN |
Ga0207668_111580271 | 3300025972 | Switchgrass Rhizosphere | TEKKRRAPMKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF |
Ga0207668_111580272 | 3300025972 | Switchgrass Rhizosphere | MKTILSALIALSVIAGVAGSASAFDAKTFYEQVDRDHN |
Ga0207668_120753011 | 3300025972 | Switchgrass Rhizosphere | LSKRRMIMKTILSALVALSVIASVAGKANALDAKSFFEQVDRDHN |
Ga0207678_101432522 | 3300026067 | Corn Rhizosphere | MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDR |
Ga0207678_102729631 | 3300026067 | Corn Rhizosphere | MKATLSALLALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0207678_103443661 | 3300026067 | Corn Rhizosphere | MKTILSALIALSVLAGFAGNAAANVDAKSFYEQVDRDRF |
Ga0207678_103452842 | 3300026067 | Corn Rhizosphere | MKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN |
Ga0207678_111980762 | 3300026067 | Corn Rhizosphere | TITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN |
Ga0207678_117972482 | 3300026067 | Corn Rhizosphere | MAMKTITSVLVALLVIAGVAGAAQAFDAKAFYERVDRSHN |
Ga0207708_100119406 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSALIALSVLAGFAGSAAADVDAKTLYEQMDRDRF |
Ga0207708_100275412 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN |
Ga0207708_102374813 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTILSALVALSVIASATGPANALDAKTFFEQVDRDHN |
Ga0207675_1005696461 | 3300026118 | Switchgrass Rhizosphere | MKTILSALVALSVIASAAGPANALDAKTFFEQVDRDHN |
Ga0209466_10966411 | 3300027646 | Tropical Forest Soil | MIMKTILSALVALSVIAGVVGSASAMDAKEFYERVDRNHF |
Ga0209466_10966412 | 3300027646 | Tropical Forest Soil | MIMKTILSALIALSVIAGVAGSASAMDAKEFYERVDRNHF |
Ga0209466_11083851 | 3300027646 | Tropical Forest Soil | MKTITSALVALLVIAGVAGAAQAFDTKTFYEQLDRDHN |
Ga0209177_100223281 | 3300027775 | Agricultural Soil | MKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN |
Ga0209177_100223282 | 3300027775 | Agricultural Soil | MKTILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF |
Ga0209177_100362701 | 3300027775 | Agricultural Soil | MKTILSALVALSVIAGIAGSANALDAKTFFEQVDRNHN |
Ga0209074_101429892 | 3300027787 | Agricultural Soil | MKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRDHN |
Ga0209074_102994772 | 3300027787 | Agricultural Soil | MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0209074_103055781 | 3300027787 | Agricultural Soil | MKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN |
Ga0209074_104262011 | 3300027787 | Agricultural Soil | MKTITSALVALLVIAGIAGTAQAFDAKTFYEQVDRNHN |
Ga0209814_101366253 | 3300027873 | Populus Rhizosphere | MKTILSALVALSVIAGVAGGTVAMDAKEFYERVDRNHF |
Ga0209814_103489221 | 3300027873 | Populus Rhizosphere | MKTILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF |
Ga0207428_100146974 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASAFDARTFYEQVDRDHN |
Ga0207428_100150843 | 3300027907 | Populus Rhizosphere | MKTVLSALIALSVIASVAGTASALDAKTFFEQVDRDHN |
Ga0207428_100219956 | 3300027907 | Populus Rhizosphere | MKTIVSALLALSVLAGVAGTVQAFDAKTFYDQVDRDHN |
Ga0207428_100219957 | 3300027907 | Populus Rhizosphere | MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0207428_100219958 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASALDAKTFYQQVDRDHY |
Ga0207428_100254054 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN |
Ga0207428_101418714 | 3300027907 | Populus Rhizosphere | TILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN |
Ga0207428_101435492 | 3300027907 | Populus Rhizosphere | MKTILSALVAFSVIASVAGPANALDAKTFFEQVDRDHN |
Ga0207428_101761192 | 3300027907 | Populus Rhizosphere | MQTITSAAVIALMLLTGIAGAAQALDAKSFYEQVDRNHN |
Ga0207428_101921601 | 3300027907 | Populus Rhizosphere | MKTILSALVALSLIAGVAGSASAFDAKDFYELVDRNHN |
Ga0207428_103104621 | 3300027907 | Populus Rhizosphere | MQTITSAVVALLLVAGVAGAAQALDAKTFYEEVDRNHN |
Ga0207428_104142263 | 3300027907 | Populus Rhizosphere | AKSMKTITSALLALLVIAGVAGAAEAIDAKAFYEQVDRNHN |
Ga0207428_104319922 | 3300027907 | Populus Rhizosphere | MTGDVAMQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN |
Ga0207428_104571384 | 3300027907 | Populus Rhizosphere | KTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN |
Ga0207428_105693112 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGAAGTASALDAKTFFEQIDRDHN |
Ga0207428_106118912 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGIAGSASAFDAKTFYEQVDRDHN |
Ga0207428_107055171 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVMAGVAGSASALDAKTFFEQVDRDHN |
Ga0207428_107931391 | 3300027907 | Populus Rhizosphere | MKTILSALVALSVIAGVAGAAVAMDAKEFYERVDRNHF |
Ga0207428_112333431 | 3300027907 | Populus Rhizosphere | MKTITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN |
Ga0209382_102241472 | 3300027909 | Populus Rhizosphere | MKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN |
Ga0209698_110818261 | 3300027911 | Watersheds | MKTILSALIALSVIAGVATSASALDAKTFYAQQDAAHN |
Ga0268264_124214822 | 3300028381 | Switchgrass Rhizosphere | MIMKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN |
Ga0268264_126183561 | 3300028381 | Switchgrass Rhizosphere | MIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN |
Ga0268264_126183562 | 3300028381 | Switchgrass Rhizosphere | TILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY |
Ga0307499_100062943 | 3300031184 | Soil | MKTILSALLALSVLAGFAGTAAADVDAKTFYEKVDRDRF |
Ga0307499_100318382 | 3300031184 | Soil | MKTILSALVVLSIIAGVANSASAFDAKDFYEQVDRNHN |
Ga0307499_100662593 | 3300031184 | Soil | MKTILSAIVALSVIAGVAGSASALDAKTFYEQVDRDHN |
Ga0307499_100662594 | 3300031184 | Soil | MKTILSALVALSVIAGVAGAASALDAKTFYEQVDRNHY |
Ga0307499_100784601 | 3300031184 | Soil | MKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN |
Ga0307499_101596191 | 3300031184 | Soil | MKTVWSVLIALSIIAGVAGTASADFDTKTFWEDLSRSAQ |
Ga0307499_101716251 | 3300031184 | Soil | MKTVWSVLIALSIIAGVAGTASAEFDTKTFWEDLSRSAR |
Ga0307499_101952131 | 3300031184 | Soil | MNGEIAMKTITSALVALLLIAGVAGTGQAFDAKTFYEQVDRNHN |
Ga0307500_102079951 | 3300031198 | Soil | MKTIVSALVALSVIAGVAGTASALDAKTFFEQVDRDHN |
Ga0307500_102509791 | 3300031198 | Soil | MKTILSAIVALSVIASVAGPANALDAKTFFEQVDRDHN |
Ga0307500_102777761 | 3300031198 | Soil | MAMKTITSALVALLFIAGVAGTAQAFDAKTFYEQVDRNHN |
Ga0310886_102338142 | 3300031562 | Soil | MKTVLSALVALSVIAGIAGSANALDAKTFYEQVDRSHYAKKD |
Ga0247727_1000077751 | 3300031576 | Biofilm | MKTIVSALIALSVIAGVATSASAFDAKTFYEQQDRAHN |
Ga0247727_1000077752 | 3300031576 | Biofilm | MKTIVSALLALSVIAGVAAPASALDAKTFFEQIDKSHY |
Ga0247727_1000077753 | 3300031576 | Biofilm | MKTIVAALLALSVIAGVATSASAFDAKTFYEQLDKNHY |
Ga0247727_101852611 | 3300031576 | Biofilm | PNRREAMKTIVSALVALSVIAGVAAPASAFDSKSFFEQQTRNLP |
Ga0307480_10080491 | 3300031677 | Hardwood Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0307480_10080492 | 3300031677 | Hardwood Forest Soil | MKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN |
Ga0307480_10089591 | 3300031677 | Hardwood Forest Soil | EPRKTGETAMKTILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY |
Ga0307480_10089592 | 3300031677 | Hardwood Forest Soil | MKTILSALVALSVLAGVAGSASAFDAKSFYEQVDRNHY |
Ga0307480_10089593 | 3300031677 | Hardwood Forest Soil | MKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN |
Ga0307480_10242661 | 3300031677 | Hardwood Forest Soil | RMIMKTILSALIVLSVIASVAGSASALDAKTFYEQVDSNHF |
Ga0307480_10242662 | 3300031677 | Hardwood Forest Soil | MKTILSALIALSVIASVAGSASALDAKTFYEQVDRDHN |
Ga0307469_100688432 | 3300031720 | Hardwood Forest Soil | MKTITSALVALLVIAGAAGTAQALDAKTFYEQVDRNHN |
Ga0307469_103914771 | 3300031720 | Hardwood Forest Soil | MQTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN |
Ga0307469_105948221 | 3300031720 | Hardwood Forest Soil | MKTITSALVALLAIAGVSGTASAFDAKTFYEQVDRNHN |
Ga0307469_106608572 | 3300031720 | Hardwood Forest Soil | MKTILSAIVALSVIAGIASSASALDAKTFYEQIDRDHN |
Ga0307469_107977502 | 3300031720 | Hardwood Forest Soil | MNTTMSALVALLVIAGVAGSANAFDAKTFYEQVDRDRN |
Ga0307469_113354221 | 3300031720 | Hardwood Forest Soil | MRTITSALVALLVIAGVSGTASAFDAKTFYEQVDRNHN |
Ga0307469_119571541 | 3300031720 | Hardwood Forest Soil | QLVNRPHQRRMIMKIILAALVALSVIASVAGSASALDAKTFFEQIDRDHN |
Ga0307468_1000098592 | 3300031740 | Hardwood Forest Soil | MKTILSTLVALSVIAGVAGTASALDAKTFFEQIDRDHN |
Ga0307468_1000424993 | 3300031740 | Hardwood Forest Soil | MKTITSALVALLVIAGITGTANAFDAKTFYEQIDRDHN |
Ga0307468_1000464601 | 3300031740 | Hardwood Forest Soil | MKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN |
Ga0307468_1002549562 | 3300031740 | Hardwood Forest Soil | MKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF |
Ga0307468_1002549563 | 3300031740 | Hardwood Forest Soil | MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHF |
Ga0307468_1002622924 | 3300031740 | Hardwood Forest Soil | MKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN |
Ga0307473_105881682 | 3300031820 | Hardwood Forest Soil | MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRDHN |
Ga0310900_102267621 | 3300031908 | Soil | MKTILSALLALSVLAGFAGTAAADVDAKTFYETVDRDRF |
Ga0310900_104663802 | 3300031908 | Soil | MKTITSALVALVLLTGITGSAKALDARSFYDQVDRNHN |
Ga0310900_105124893 | 3300031908 | Soil | MKTILSALVALSVIAGVAGAASALDAKTFYEQVDRDHN |
Ga0310900_112126792 | 3300031908 | Soil | MKTITSALVALLLIAGVAGTAQAFDAKTFYEQLDRNHN |
Ga0310900_115340902 | 3300031908 | Soil | TGETIMKTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN |
Ga0214473_122100292 | 3300031949 | Soil | MKTILSALIALSALAGIAASASAADLDAKTYFEQMDRSRY |
Ga0306926_124934612 | 3300031954 | Soil | MKTILSALIALSVLVGIAGSAAAFDAKTFYEQQGRSHY |
Ga0310902_108346782 | 3300032012 | Soil | MKTITSALVALLLIAGVAGTAQAFDAKTFYEQADRNHN |
Ga0307470_100333143 | 3300032174 | Hardwood Forest Soil | MKTILSALLALSVLAGFAGAAAANVDAKTFYEQVDRDRF |
Ga0307470_101587162 | 3300032174 | Hardwood Forest Soil | MAMKTITSALVALLVIAGVAGVAQAFDAKAFYERVDRSHN |
Ga0307470_102041402 | 3300032174 | Hardwood Forest Soil | MKTITSALVALLVIAGITGTANAFDAKTFYEQIDRDPN |
Ga0307470_107259064 | 3300032174 | Hardwood Forest Soil | EIMKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHF |
Ga0307470_109079352 | 3300032174 | Hardwood Forest Soil | VKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF |
Ga0307470_109262271 | 3300032174 | Hardwood Forest Soil | NTKKRRMIMKTILSALIALSVIASVAGSASAFDAKTFYEQVDRDHN |
Ga0310889_106579583 | 3300032179 | Soil | YQKRRMIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0307471_1001395543 | 3300032180 | Hardwood Forest Soil | MKTILSAIVALSVIAGVASSASALDAKTFYEQIDRDHN |
Ga0307471_1004356723 | 3300032180 | Hardwood Forest Soil | MKTILSALIALSVIAGVAGSASALDAKTFYEQVDSNHF |
Ga0307471_1004356724 | 3300032180 | Hardwood Forest Soil | MKTILSAVVALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0307471_1009123211 | 3300032180 | Hardwood Forest Soil | QRRMIMKIILAALVALSVIASVAGSASALDAKTFFEQIDRDHN |
Ga0307472_1004549082 | 3300032205 | Hardwood Forest Soil | MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN |
Ga0307472_1009131754 | 3300032205 | Hardwood Forest Soil | AMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0307472_1015425241 | 3300032205 | Hardwood Forest Soil | MKTILSALVALSVIAGVAGTASALDAKTFFEQIDRDHN |
Ga0307472_1017947691 | 3300032205 | Hardwood Forest Soil | MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHNSRADPRPGRPAR |
Ga0314862_0188364_401_511 | 3300033803 | Peatland | MKILVSAILALSVLAGAAASASALDAKTFYEQQDRSH |
Ga0314781_078459_466_585 | 3300034660 | Soil | MKTILSALTALSVLAGFAGNAAANVDAKSFYEQVDRDRF |
Ga0314782_161934_171_293 | 3300034661 | Soil | MIMKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN |
Ga0314782_161934_343_465 | 3300034661 | Soil | MIMKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF |
Ga0314794_082409_11_133 | 3300034669 | Soil | MIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRNHY |
Ga0314795_063650_232_354 | 3300034670 | Soil | MIMKTILSARVALSVIAGVAGAASALDAKTFYEQVDRDHN |
Ga0314795_126782_14_136 | 3300034670 | Soil | MIMKTIVSALIALSVIAGVAGSASALDAKTFYEQVDRNHY |
Ga0314795_126782_173_295 | 3300034670 | Soil | MIMKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN |
Ga0314796_172417_383_505 | 3300034671 | Soil | MIMNPTLASFVALWFIAGVPGAASALDAKTFYEQVDRNHY |
Ga0314797_132480_42_158 | 3300034672 | Soil | LTTILTAFVAFGFRAGVAGPASALDAKTFYEQVDRNHY |
Ga0373948_0031554_567_683 | 3300034817 | Rhizosphere Soil | MKTILSALLAHSVIASVVGPANALDAKTFFEQVDRDHN |
Ga0373948_0151482_347_463 | 3300034817 | Rhizosphere Soil | MKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN |
Ga0373950_0025762_591_713 | 3300034818 | Rhizosphere Soil | MIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN |
Ga0373950_0117692_5_121 | 3300034818 | Rhizosphere Soil | MQTITSALIALLLVAGLASTAQALDAKTFYGEVDRNRN |
Ga0373958_0150531_408_524 | 3300034819 | Rhizosphere Soil | MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRNHN |
Ga0373958_0197503_49_183 | 3300034819 | Rhizosphere Soil | MTGDVAMQTITSALIALLLVAGLAGAAQALDAKTFYGEVDRNRN |
Ga0373959_0142653_237_371 | 3300034820 | Rhizosphere Soil | MTGDVAMQTITSALIALLLVAGLAGAAQALDAKTFYGEVDRNHN |
⦗Top⦘ |